MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : B-licheniformis 20211213 (4,284 sequences; 1,240,737 residues)
Timestamp : 4 Dec 2025 at 15:32:34 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 18 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1–100 (out of 7572)


Page: 1 2 3 4 5 6  76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
1114 468.2127 1868.8217 1868.8284 -3.59 1 19 0.06 +1Score > 19 indicates identity IDDMRDNEFPIMETK + Oxidation (M)
145 387.1759 1544.6744 1544.6994 -16.2 0 17 0.054 +1Score > 17 indicates identity DGSLYAGYTNNIEK + Deamidated (NQ)
4449 738.3355 1474.6565 1474.6472 6.27 0 16 0.13 +1Score > 20 indicates identity SSFVCYMPNELK + Deamidated (NQ)
601 427.6943 853.3741 853.3673 7.87 1 16 0.055 +1Score > 16 indicates identity NMADMKK + Deamidated (NQ); Oxidation (M)
4611 751.8416 3003.3374 3003.3808 -14.5 1 16 0.059 +1Score > 16 indicates identity RSFDIQDGVIEMGEFSPVVDQSFQEK + Deamidated (NQ); Oxidation (M)
2451 576.2618 1725.7637 1725.7628 0.53 0 16 0.13 +1Score > 20 indicates identity MNQAIAADFQAADTSR + Deamidated (NQ); Oxidation (M)
448 414.1881 1239.5426 1239.5230 15.8 0 16 0.12 +1Score > 19 indicates identity IYYGNYGSMR + Deamidated (NQ); Oxidation (M)
2361 562.7557 2246.9936 2247.0114 -7.91 1 15 0.094 +1Score > 18 indicates identity SKDEFGQLGTSFNEMADSLR + Oxidation (M)
846 441.2004 880.3863 880.3960 -11.0 0 15 0.16 +1Score > 19 indicates identity TGTMTQNK + Deamidated (NQ)
445 414.1881 1239.5426 1239.5329 7.82 0 15 0.16 +1Score > 19 indicates identity DNEFPIMETK + Deamidated (NQ); Oxidation (M)
942 454.7066 907.3986 907.3957 3.23 0 15 0.14 +1Score > 19 indicates identity EMNGLAEK + Deamidated (NQ); Oxidation (M)
126 387.1759 1544.6744 1544.6994 -16.2 0 14 0.097 +1Score > 17 indicates identity DGSLYAGYTNNIEK + Deamidated (NQ)
2435 576.2618 1725.7637 1725.7735 -5.71 1 14 0.19 +1Score > 20 indicates identity MLSKDMQNVLDEMR + Deamidated (NQ); Oxidation (M)
1571 508.7311 2030.8955 2030.9142 -9.25 0 14 0.09 +1Score > 16 indicates identity EAGLSDEEALMYAFEAGTK
2092 549.2496 1096.4846 1096.4978 -12.0 0 14 0.073 +1Score > 20 indicates identity
Score > 15 indicates homology
YYGYTGAFR
396 414.1881 1239.5426 1239.5587 -13.0 1 14 0.18 +1Score > 19 indicates identity MMTAKNLQDR + Deamidated (NQ); 2 Oxidation (M)
125 387.1759 1544.6744 1544.6994 -16.2 0 14 0.1 +1Score > 17 indicates identity DGSLYAGYTNNIEK + Deamidated (NQ)
4445 738.3355 2211.9847 2212.0028 -8.16 1 14 0.071 +1Score > 20 indicates identity
Score > 15 indicates homology
MDNQELTMPTKYDPSAVEK + Oxidation (M)
1091 468.2127 1401.6163 1401.6273 -7.84 1 14 0.18 +1Score > 19 indicates identity TEHDNPRDVYR + Deamidated (NQ)
1776 522.2372 1563.6899 1563.7086 -12.0 1 14 0.2 +1Score > 19 indicates identity LEKNGEMTEDELR + Deamidated (NQ)
118 387.1759 772.3372 772.3351 2.67 0 14 0.11 +1Score > 17 indicates identity DPDQAAR + Deamidated (NQ)
292 400.6820 1598.6989 1598.7181 -12.0 1 13 0.1 +1Score > 16 indicates identity MKQAFESAAAEMGGR + Oxidation (M)
962 454.7066 1814.7972 1814.8033 -3.34 0 13 0.19 +1Score > 19 indicates identity GDTLWGISQNYGMNLK + 3 Deamidated (NQ); Oxidation (M)
5474 819.3723 2455.0951 2455.1069 -4.80 0 13 0.24 +1Score > 20 indicates identity SVQALEQAMMNDHMIFLATQK + 2 Deamidated (NQ); 3 Oxidation (M)
3922 697.8171 2787.2392 2787.2255 4.93 0 13 0.16 +1Score > 17 indicates identity NMNQAMAYIEEHLTDSIDFQTVAK + 3 Deamidated (NQ); Oxidation (M)
781 441.2004 1320.5795 1320.6058 -19.9 1 13 0.24 +1Score > 19 indicates identity DNNRVGFAEAAR + 2 Deamidated (NQ)
2533 576.2618 1150.5091 1150.5288 -17.1 1 13 0.26 +1Score > 20 indicates identity GDTKMLEGER + Oxidation (M)
1134 468.2127 1868.8217 1868.8462 -13.1 0 13 0.23 +1Score > 19 indicates identity TEMLTNNIANANTPGYK + 2 Deamidated (NQ); Oxidation (M)
1010 454.7066 1814.7972 1814.8179 -11.4 1 13 0.21 +1Score > 19 indicates identity FGMDDSTPIQSKMVSR + Deamidated (NQ); Oxidation (M)
2471 576.2618 1725.7637 1725.7628 0.53 0 13 0.28 +1Score > 20 indicates identity MNQAIAADFQAADTSR + Deamidated (NQ); Oxidation (M)
7260 954.4337 2860.2793 2860.3254 -16.1 1 13 0.23 +1Score > 19 indicates identity NEIYVLCMEEDIMKVVNLLMENK + 2 Deamidated (NQ); 2 Oxidation (M)
449 414.1881 1239.5426 1239.5329 7.82 0 12 0.26 +1Score > 19 indicates identity DNEFPIMETK + Deamidated (NQ); Oxidation (M)
453 414.1881 826.3617 826.3643 -3.15 0 12 0.28 +1Score > 19 indicates identity MYVDGAR + Oxidation (M)
2007 535.7434 1069.4723 1069.4572 14.1 1 12 0.17 +1Score > 17 indicates identity MWQKEMGK + Deamidated (NQ); 2 Oxidation (M)
5109 792.3600 2374.0583 2374.0821 -10.0 1 12 0.13 +1Score > 20 indicates identity
Score > 16 indicates homology
QGDPGITQFYLSMEDELMKR + Deamidated (NQ); Oxidation (M)
789 441.2004 880.3863 880.3960 -11.0 0 12 0.3 +1Score > 19 indicates identity DAMASGVSK + Oxidation (M)
235 400.6820 1598.6989 1598.6812 11.1 0 12 0.14 +1Score > 16 indicates identity MLMQVMQDPEMAK + 3 Oxidation (M)
776 441.2004 1320.5795 1320.6058 -19.9 1 12 0.31 +1Score > 19 indicates identity DNNRVGFAEAAR + 2 Deamidated (NQ)
2613 589.7679 1177.5213 1177.5211 0.22 0 12 0.19 +1Score > 17 indicates identity GTSQINASQNR + 3 Deamidated (NQ)
3158 630.2864 1258.5582 1258.5387 15.5 1 12 0.32 +1Score > 19 indicates identity MSKYEDDNLK + Deamidated (NQ); Oxidation (M)
466 414.1881 1239.5426 1239.5554 -10.3 1 12 0.3 +1Score > 19 indicates identity FQAQEREMGK + Deamidated (NQ); Oxidation (M)
227 400.6820 1598.6989 1598.6956 2.06 0 12 0.15 +1Score > 16 indicates identity NGPQGFLAADMMSVK + 2 Deamidated (NQ); 2 Oxidation (M)
2708 589.7679 1177.5213 1177.5211 0.22 0 12 0.2 +1Score > 17 indicates identity GTSQINASQNR + 3 Deamidated (NQ)
280 400.6820 1598.6989 1598.7181 -12.0 1 12 0.15 +1Score > 16 indicates identity MKQAFESAAAEMGGR + Oxidation (M)
151 387.1759 772.3372 772.3286 11.1 0 11 0.19 +1Score > 17 indicates identity MNHESR
4102 711.3232 2130.9479 2130.9602 -5.75 0 11 0.35 +1Score > 19 indicates identity MGGQYIFSSVPIMNAEQNK + 2 Deamidated (NQ); Oxidation (M)
206 400.6820 1598.6989 1598.7246 -16.1 1 11 0.16 +1Score > 16 indicates identity REDMLQLFSDSDK + Oxidation (M)
2706 589.7679 1177.5213 1177.5211 0.22 0 11 0.22 +1Score > 17 indicates identity GTSQINASQNR + 3 Deamidated (NQ)
1199 481.7188 961.4231 961.4361 -13.5 0 11 0.21 +1Score > 17 indicates identity MAAAGGEPMK
891 454.7066 1814.7972 1814.8257 -15.7 1 11 0.3 +1Score > 19 indicates identity LLDNAFRYADQMGQR + 2 Deamidated (NQ); Oxidation (M)
2450 576.2618 1150.5091 1150.5077 1.25 0 11 0.38 +1Score > 20 indicates identity NMGDPLFANR + Deamidated (NQ); Oxidation (M)
129 387.1759 1544.6744 1544.6995 -16.2 0 11 0.2 +1Score > 17 indicates identity DYTLSDNGSGFEIK
675 427.6943 1706.7481 1706.7801 -18.7 0 11 0.16 +1Score > 16 indicates identity FHNDPDHEWILER
1796 522.2372 1042.4599 1042.4753 -14.8 1 11 0.36 +1Score > 19 indicates identity EFMKETSR + Oxidation (M)
2099 549.2496 1096.4846 1096.4794 4.75 0 11 0.14 +1Score > 20 indicates identity
Score > 15 indicates homology
MFQQQPMR + 2 Oxidation (M)
5081 778.8539 1555.6932 1555.7114 -11.7 1 11 0.29 +1Score > 18 indicates identity HSGENQEEQRLVK + 3 Deamidated (NQ)
5615 832.8785 1663.7424 1663.7624 -12.0 1 11 0.23 +1Score > 17 indicates identity NRMNGGWETIVNQK + 2 Deamidated (NQ); Oxidation (M)
6872 927.4214 1852.8283 1852.8512 -12.4 0 11 0.35 +1Score > 20 indicates identity
Score > 19 indicates homology
TEMLTNNIANANTPGYK + 2 Deamidated (NQ)
1441 495.2250 1482.6531 1482.6694 -11.0 1 11 0.35 +1Score > 19 indicates identity TIAMKIQDDMER + Deamidated (NQ); 2 Oxidation (M)
155 387.1759 1544.6744 1544.6994 -16.2 0 11 0.21 +1Score > 17 indicates identity DGSLYAGYTNNIEK + Deamidated (NQ)
2447 576.2618 1725.7637 1725.7628 0.53 0 11 0.42 +1Score > 20 indicates identity MNQAIAADFQAADTSR + Deamidated (NQ); Oxidation (M)
3448 657.2986 1968.8741 1968.9132 -19.9 1 11 0.42 +1Score > 19 indicates identity KSSGLGTLEQGEMIESMR + Deamidated (NQ); Oxidation (M)
3698 670.8048 2679.1901 2679.1983 -3.04 1 11 0.32 +1Score > 18 indicates identity AIQNGGHEIGNHSYNHPDMSKLTR + 4 Deamidated (NQ)
2256 562.7557 1123.4968 1123.5002 -3.00 0 11 0.28 +1Score > 18 indicates identity GMGIIGMEER + 2 Oxidation (M)
89 387.1759 772.3372 772.3248 16.1 0 11 0.23 +1Score > 17 indicates identity MNAYMK + Oxidation (M)
379 414.1881 826.3617 826.3643 -3.15 0 11 0.4 +1Score > 19 indicates identity MTAGFQR + Deamidated (NQ); Oxidation (M)
3457 657.2986 1312.5827 1312.5574 19.3 0 10 0.44 +1Score > 19 indicates identity MQTGMSVQEMR + Oxidation (M)
1420 495.2250 1482.6531 1482.6330 13.6 1 10 0.39 +1Score > 19 indicates identity MDQNQQKLTAMR + 4 Deamidated (NQ); Oxidation (M)
428 414.1881 826.3617 826.3643 -3.15 0 10 0.41 +1Score > 19 indicates identity MYVDGAR + Oxidation (M)
795 441.2004 1320.5795 1320.6058 -19.9 1 10 0.44 +1Score > 19 indicates identity DNNRVGFAEAAR + 2 Deamidated (NQ)
5064 778.8539 1555.6932 1555.7163 -14.8 1 10 0.34 +1Score > 18 indicates identity YYPHQQGMIMKK + Deamidated (NQ); 2 Oxidation (M)
3924 697.8171 1393.6196 1393.6269 -5.25 1 10 0.29 +1Score > 17 indicates identity HGQSRGPMSHGSR + Deamidated (NQ)
502 414.1881 1239.5426 1239.5554 -10.3 1 10 0.43 +1Score > 19 indicates identity FQAQEREMGK + Deamidated (NQ); Oxidation (M)
5078 778.8539 1555.6932 1555.7163 -14.8 1 10 0.35 +1Score > 18 indicates identity YYPHQQGMIMKK + Deamidated (NQ); 2 Oxidation (M)
929 454.7066 1814.7972 1814.8145 -9.56 0 10 0.38 +1Score > 19 indicates identity FDDFTVVECQLETGR
2934 616.7802 1231.5459 1231.5680 -18.0 0 10 0.29 +1Score > 17 indicates identity AEASIQEAEQR + Deamidated (NQ)
810 441.2004 880.3863 880.3848 1.77 0 10 0.46 -1Score > 19 indicates identity NEMIQTK + 2 Deamidated (NQ); Oxidation (M)
1490 495.2250 988.4354 988.4219 13.7 0 10 0.42 +1Score > 19 indicates identity GNHEVMMR + Oxidation (M)
4263 724.8293 1447.6441 1447.6215 15.6 0 10 0.29 +1Score > 17 indicates identity QWSAEDEEAVQR + Deamidated (NQ)
64 387.1759 772.3372 772.3248 16.1 0 10 0.25 +1Score > 17 indicates identity MNAYMK + Oxidation (M)
2874 603.2741 1204.5337 1204.5571 -19.5 0 10 0.44 +1Score > 19 indicates identity STAEAENVDIR + Deamidated (NQ)
420 414.1881 826.3617 826.3643 -3.15 0 10 0.46 +1Score > 19 indicates identity MTAGFQR + Deamidated (NQ); Oxidation (M)
961 454.7066 907.3986 907.3957 3.22 0 10 0.4 +1Score > 19 indicates identity QIQDEMK + Deamidated (NQ); Oxidation (M)
82 387.1759 772.3372 772.3351 2.65 0 10 0.26 +1Score > 17 indicates identity DGTHSEK
2127 549.2496 1644.7269 1644.7090 10.9 0 10 0.27 +1Score > 20 indicates identity
Score > 17 indicates homology
GASGYAPENTMAAFDK + Oxidation (M)
667 427.6943 1706.7481 1706.7668 -11.0 0 10 0.22 +1Score > 16 indicates identity MTEQNAIDQIEQLR + 3 Deamidated (NQ); Oxidation (M)
147 387.1759 1544.6744 1544.6969 -14.6 0 10 0.27 +1Score > 17 indicates identity NFQPMNANFGLFK + 2 Deamidated (NQ); Oxidation (M)
2819 603.2741 2409.0673 2409.0828 -6.41 0 10 0.47 +1Score > 19 indicates identity MQLQVMNSPFNQEQAELLNR + 4 Deamidated (NQ); Oxidation (M)
2081 549.2496 1644.7269 1644.7090 10.9 0 10 0.6 +1Score > 20 indicates identity GASGYAPENTMAAFDK + Oxidation (M)
288 400.6820 1598.6989 1598.6956 2.06 0 10 0.23 +1Score > 16 indicates identity MNTVVTNMAGNVWK + 3 Deamidated (NQ); 2 Oxidation (M)
4439 738.3355 2211.9847 2212.0028 -8.16 1 10 0.55 +1Score > 20 indicates identity MDNQELTMPTKYDPSAVEK + Oxidation (M)
6297 886.9030 3543.5830 3543.6075 -6.92 0 10 0.32 +1Score > 17 indicates identity NGQWQMMTEPINYDRPVSGVGLAASFADAWSK + 2 Deamidated (NQ); Oxidation (M)
1633 508.7311 2030.8955 2030.9111 -7.73 0 10 0.25 +1Score > 16 indicates identity ISSGSFQTDGMIVAPCSMK + Oxidation (M)
1468 495.2250 988.4354 988.4219 13.7 0 10 0.47 +1Score > 19 indicates identity GNHEVMMR + Oxidation (M)
948 454.7066 907.3986 907.4069 -9.14 1 10 0.43 +1Score > 19 indicates identity QNNVMKR + 3 Deamidated (NQ); Oxidation (M)
1599 508.7311 2030.8955 2030.8792 7.98 0 10 0.26 +1Score > 16 indicates identity TAEWGNQWITDHICDGK + Deamidated (NQ)
481 414.1881 1239.5426 1239.5475 -3.94 0 10 0.51 +1Score > 19 indicates identity MNQLMNSEIK + Deamidated (NQ); 2 Oxidation (M)
1486 495.2250 1482.6531 1482.6409 8.25 0 10 0.49 +1Score > 19 indicates identity NDNHSPAPQMINK + 2 Deamidated (NQ); Oxidation (M)
928 454.7066 907.3986 907.4035 -5.46 0 9 0.45 +1Score > 19 indicates identity DENDLFR
49 387.1759 772.3372 772.3248 16.1 0 9 0.3 +1Score > 17 indicates identity MNAYMK + Oxidation (M)
Page: 1 2 3 4 5 6  76 Next 

Not what you expected? Try the select summary.