| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | test |
| MS data file | : | PRT1346_ENIGMA_14.mgf |
| Database | : | Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues) |
| Timestamp | : | 4 Dec 2025 at 15:28:39 GMT |
Not what you expected? Try
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | |
| Variable modifications | : | |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 7,621 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 | 2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | ||||
| 6.2e-007 | 1 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | ||||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle (
) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 562.7557 | 2246.9936 | 2246.9606 | 14.7 | 0 | 3 | 1.9 | 1Score > 18 indicates identity |
HNIEAQHMTIDTNGQMVMK + 2 Deamidated (NQ); 3 Oxidation (M) | |
| 616.7802 | 2463.0917 | 2463.1051 | -5.42 | 0 | 3 | 1.8 | 1Score > 18 indicates identity |
VDGNLNSFELTGQAGADNHFNSR + Deamidated (NQ) | |
| 670.8048 | 1339.5951 | 1339.6004 | -4.02 | 0 | 3 | 2.3 | 1Score > 19 indicates identity |
ESGGDFASVTGGTR | |
| 454.7066 | 907.3986 | 907.3883 | 11.4 | 0 | 3 | 1.6 | 1Score > 17 indicates identity |
ATSEQSER + Deamidated (NQ) | |
| 886.9030 | 3543.5830 | 3543.6287 | -12.9 | 1 | 3 | 2.3 | 1Score > 19 indicates identity |
QQEMNTQTGRFAADMQVSLVNDGPVTFWLQV + 2 Deamidated (NQ); 2 Oxidation (M) | |
| 886.9030 | 3543.5830 | 3543.6268 | -12.4 | 0 | 3 | 2.3 | 1Score > 19 indicates identity |
WAPLWVIDFPMFEDDGEGGLTAMHHPFTSPK + Oxidation (M) | |
| 387.1759 | 1544.6744 | 1544.6889 | -9.41 | 0 | 3 | 1.2 | 1Score > 16 indicates identity |
QAGCTLHEVGTTNR + 2 Deamidated (NQ) | |
| 724.8293 | 2895.2883 | 2895.3387 | -17.4 | 1 | 3 | 1.9 | 1Score > 18 indicates identity |
WCRTNAVDVVLMDMSMPGIGGLEATR + Deamidated (NQ); Oxidation (M) | |
| 738.3355 | 2949.3129 | 2949.3208 | -2.66 | 0 | 3 | 0.68 | 1Score > 20 indicates identityScore > 14 indicates homology |
EWAQAGFLNIVGGCCGTTPQHIAAMSR + 2 Deamidated (NQ); Oxidation (M) | |
| 765.3478 | 1528.6810 | 1528.6688 | 7.97 | 1 | 3 | 1 | 1Score > 21 indicates identityScore > 15 indicates homology |
VTAGNHCDNLRNR + 3 Deamidated (NQ) | |
| 927.4214 | 1852.8283 | 1852.8375 | -4.96 | 1 | 3 | 1 | 1Score > 21 indicates identityScore > 15 indicates homology |
GYDVLQYFEMMKEGK + Oxidation (M) | |
| 427.6943 | 1706.7481 | 1706.7576 | -5.58 | 0 | 3 | 1.1 | 1Score > 16 indicates identity |
QFDTYNLWNTFTR + 2 Deamidated (NQ) | |
| 805.8662 | 3219.4357 | 3219.4973 | -19.1 | 1 | 3 | 2 | 1Score > 19 indicates identity |
VAMMNRLQQALEHNHFFLMAQPITGMR + 4 Deamidated (NQ); 2 Oxidation (M) | |
| 454.7066 | 907.3986 | 907.3891 | 10.4 | 0 | 3 | 1.6 | 1Score > 17 indicates identity |
DMAMNQAK | |
| 765.3478 | 3057.3620 | 3057.4162 | -17.7 | 1 | 3 | 1 | 1Score > 21 indicates identityScore > 15 indicates homology |
LEPQAEDAPLNNYANERLTQLNQQQR + 5 Deamidated (NQ) | |
| 873.3969 | 2617.1689 | 2617.1552 | 5.23 | 1 | 3 | 1 | 1Score > 22 indicates identityScore > 15 indicates homology |
NFESVGMGLMETGMAWFWPDRR + Deamidated (NQ) | |
| 414.1881 | 1239.5426 | 1239.5661 | -19.0 | 0 | 3 | 2.4 | 1Score > 19 indicates identity |
SPMELMTMLR + 2 Oxidation (M) | |
| 630.2864 | 2517.1164 | 2517.0722 | 17.5 | 1 | 3 | 0.74 | 1Score > 20 indicates identityScore > 14 indicates homology |
NNYIHDLDMAAERMFTESGMR + Deamidated (NQ); Oxidation (M) | |
| 913.9153 | 1825.8160 | 1825.8226 | -3.62 | 0 | 3 | 2.3 | 1Score > 19 indicates identity |
DIGMPELSDEMLGFTR + Oxidation (M) | |
| 954.4337 | 2860.2793 | 2860.3185 | -13.7 | 1 | 3 | 1 | 1Score > 21 indicates identityScore > 15 indicates homology |
TVLGAQSAVKYIVCNADEGDSGTFSDR + Deamidated (NQ) | |
| 927.4214 | 2779.2425 | 2779.2577 | -5.46 | 1 | 3 | 1 | 1Score > 21 indicates identityScore > 15 indicates homology |
FSQTMMWIDTVNGLIMVDCASAKK + 2 Deamidated (NQ); 2 Oxidation (M) | |
| 508.7311 | 1015.4477 | 1015.4611 | -13.1 | 0 | 3 | 1.4 | 1Score > 17 indicates identity |
YYDAETVR | |
| 630.2864 | 2517.1164 | 2517.1189 | -1.00 | 1 | 3 | 1 | 1Score > 20 indicates identityScore > 15 indicates homology |
KLQLSMDPMLDMMGMQMLMEK + Deamidated (NQ); Oxidation (M) | |
| 684.3109 | 2049.9109 | 2049.9479 | -18.0 | 1 | 3 | 0.83 | 1Score > 20 indicates identityScore > 15 indicates homology |
IEHYHDWLRDAHAMEK | |
| 711.3232 | 2841.2639 | 2841.2570 | 2.41 | 1 | 3 | 0.64 | 1Score > 21 indicates identityScore > 13 indicates homology |
LPPASSSTTSGASNTSSTSQGDIMDQRR + 3 Deamidated (NQ) | |
| 940.9276 | 3759.6811 | 3759.7468 | -17.5 | 1 | 3 | 2.4 | 1Score > 19 indicates identity |
EGHHTSAEDLRDYVMQVIDATAENISSMLQDIR + Oxidation (M) | |
| 387.1759 | 1544.6744 | 1544.6889 | -9.41 | 0 | 3 | 1.3 | 1Score > 16 indicates identity |
QAGCTLHEVGTTNR + 2 Deamidated (NQ) | |
| 454.7066 | 907.3986 | 907.4069 | -9.16 | 0 | 3 | 1.6 | 1Score > 17 indicates identity |
AALDNMTR + Deamidated (NQ); Oxidation (M) | |
| 535.7434 | 2138.9445 | 2138.9716 | -12.7 | 1 | 3 | 1.7 | 1Score > 18 indicates identity |
ITGSQVKNNGYVQDTNNQR + 4 Deamidated (NQ) | |
| 549.2496 | 1096.4846 | 1096.4753 | 8.44 | 1 | 3 | 0.7 | 1Score > 20 indicates identityScore > 14 indicates homology |
GDARMMASSR + Oxidation (M) | |
| 562.7557 | 1123.4968 | 1123.4894 | 6.60 | 0 | 3 | 1.9 | 1Score > 18 indicates identity |
NLNDTNYNR + Deamidated (NQ) | |
| 846.3846 | 2536.1319 | 2536.1322 | -0.10 | 0 | 3 | 0.64 | 1Score > 20 indicates identityScore > 13 indicates homology |
AASMITESQCYQLEQNLHQQR + 2 Deamidated (NQ) | |
| 481.7188 | 1922.8463 | 1922.8754 | -15.1 | 0 | 3 | 1.8 | 1Score > 18 indicates identity |
VSAVLMEQGQMIWQQR + 4 Deamidated (NQ); Oxidation (M) | |
| 846.3846 | 3381.5092 | 3381.5291 | -5.87 | 0 | 3 | 1 | 1Score > 20 indicates identityScore > 15 indicates homology |
DGCIAIACPITGDWVAMTNHTWAFSIAEMK + Oxidation (M) | |
| 576.2618 | 1725.7637 | 1725.7628 | 0.53 | 0 | 3 | 1 | 1Score > 20 indicates identityScore > 15 indicates homology |
SEQNNTEMTFQIQR + Deamidated (NQ) | |
| 913.9153 | 3651.6320 | 3651.6920 | -16.4 | 1 | 3 | 2.3 | 1Score > 19 indicates identity |
NVMLGGGDNALMLPEQASNIRLQSSETPQEIFR + 5 Deamidated (NQ); 2 Oxidation (M) | |
| 927.4214 | 2779.2425 | 2779.2945 | -18.7 | 0 | 3 | 1 | 1Score > 21 indicates identityScore > 15 indicates homology |
GMNLVGYDAMAIGNHEFDNPLTVLR + Deamidated (NQ); 2 Oxidation (M) | |
| 454.7066 | 907.3986 | 907.4069 | -9.16 | 0 | 3 | 1.6 | 1Score > 17 indicates identity |
AALDNMTR + Deamidated (NQ); Oxidation (M) | |
| 468.2127 | 934.4109 | 934.4192 | -8.88 | 0 | 3 | 0.6 | 1Score > 20 indicates identityScore > 13 indicates homology |
HHSPACAR | |
| 630.2864 | 1887.8373 | 1887.8172 | 10.7 | 1 | 3 | 0.64 | 1Score > 20 indicates identityScore > 13 indicates homology |
DTPFFSGYKMTYMQR + Deamidated (NQ); Oxidation (M) | |
| 643.7925 | 2571.1411 | 2571.1547 | -5.30 | 1 | 3 | 2 | 1Score > 18 indicates identity |
AHFSYSDSAEMLSGNSDLNEKLR + Deamidated (NQ) | |
| 657.2986 | 1968.8741 | 1968.9098 | -18.1 | 1 | 3 | 1 | 1Score > 21 indicates identityScore > 15 indicates homology |
GEAGQQVNIKIMEYSER + 2 Deamidated (NQ); Oxidation (M) | |
| 954.4337 | 1906.8529 | 1906.8513 | 0.82 | 1 | 3 | 0.79 | 1Score > 21 indicates identityScore > 14 indicates homology |
DDVNEVRNGMECGIGVK + Oxidation (M) | |
| 576.2618 | 1725.7637 | 1725.7668 | -1.83 | 1 | 3 | 0.98 | 1Score > 20 indicates identityScore > 15 indicates homology |
FETDKWDVMDADVR | |
| 643.7925 | 2571.1411 | 2571.1880 | -18.2 | 1 | 3 | 2 | 1Score > 18 indicates identity |
HDSSVTGIMMSLCSERFVSSLGR + Oxidation (M) | |
| 711.3232 | 2841.2639 | 2841.3174 | -18.8 | 0 | 3 | 1 | 1Score > 21 indicates identityScore > 15 indicates homology |
MASENMTPQDYIGHHLNNLQLDLR + 2 Oxidation (M) | |
| 765.3478 | 3057.3620 | 3057.3405 | 7.02 | 1 | 3 | 0.85 | 1Score > 21 indicates identityScore > 15 indicates homology |
ECEEMMIKLFGEPVAFDEEQPQQTR + Deamidated (NQ); Oxidation (M) | |
| 819.3723 | 2455.0951 | 2455.1060 | -4.45 | 0 | 3 | 0.58 | 1Score > 21 indicates identityScore > 13 indicates homology |
NAGDFNLNMNSGSETAVDSIVGLK + 3 Deamidated (NQ) | |
| 495.2250 | 1976.8708 | 1976.8996 | -14.6 | 0 | 3 | 0.78 | 1Score > 20 indicates identityScore > 14 indicates homology |
AASEEVINMLSQANPQTR + 3 Deamidated (NQ); Oxidation (M) | |
| 549.2496 | 2192.9692 | 2192.9500 | 8.75 | 1 | 3 | 1 | 1Score > 20 indicates identityScore > 15 indicates homology |
MHGNSEMQKINQTSAMPEK + Deamidated (NQ); 2 Oxidation (M) | |
| 508.7311 | 1015.4477 | 1015.4458 | 1.91 | 0 | 3 | 1.4 | 1Score > 17 indicates identity |
GNNQPDIQK + 3 Deamidated (NQ) | |
| 414.1881 | 1652.7235 | 1652.7278 | -2.62 | 1 | 3 | 2.5 | 1Score > 19 indicates identity |
RFNTANDDNVTQVR + 4 Deamidated (NQ) | |
| 751.8416 | 3003.3374 | 3003.3403 | -1.00 | 0 | 3 | 2.3 | 1Score > 19 indicates identity |
QEPYENVTLDVEEQHQGSVMQALGER + 2 Deamidated (NQ); Oxidation (M) | |
| 414.1881 | 1239.5426 | 1239.5553 | -10.3 | 1 | 3 | 2.5 | 1Score > 19 indicates identity |
QKMAENNGGYK + Deamidated (NQ) | |
| 508.7311 | 1015.4477 | 1015.4458 | 1.91 | 0 | 3 | 1.4 | 1Score > 17 indicates identity |
GNNQPDIQK + 3 Deamidated (NQ) | |
| 630.2864 | 2517.1164 | 2517.1239 | -2.99 | 1 | 3 | 1 | 1Score > 20 indicates identityScore > 15 indicates homology |
LYDRGSNGFWPGEGCGMVVLMR + Deamidated (NQ); Oxidation (M) | |
| 778.8539 | 1555.6932 | 1555.7049 | -7.52 | 1 | 3 | 2 | 1Score > 18 indicates identity |
SSMTLGAGGSSPSHKH + Oxidation (M) | |
| 873.3969 | 3489.5585 | 3489.5641 | -1.58 | 1 | 3 | 1 | 1Score > 22 indicates identityScore > 15 indicates homology |
NIAMVFQNYALYPHMTVYDNMAFGLKMQK + 4 Deamidated (NQ); 3 Oxidation (M) | |
| 414.1881 | 826.3617 | 826.3677 | -7.23 | 0 | 3 | 2.5 | 1Score > 19 indicates identity |
MATVSMR + 2 Oxidation (M) | |
| 670.8048 | 2679.1901 | 2679.1983 | -3.06 | 1 | 3 | 2.5 | 1Score > 19 indicates identity |
TQLDSAGYRHVDQVMEHGEYATR + Deamidated (NQ); Oxidation (M) | |
| 792.3600 | 2374.0583 | 2374.0755 | -7.25 | 1 | 3 | 0.59 | 1Score > 21 indicates identityScore > 13 indicates homology |
CVNEGKPNEYNLYRMMIDK + Deamidated (NQ) | |
| 832.8785 | 3327.4848 | 3327.5162 | -9.44 | 1 | 3 | 2.5 | 1Score > 19 indicates identity |
IDTNQCIDSKNIDIYTPEQIIAMGWQNK + 4 Deamidated (NQ); Oxidation (M) | |
| 576.2618 | 1150.5091 | 1150.5111 | -1.68 | 0 | 3 | 1 | 1Score > 20 indicates identityScore > 15 indicates homology |
MEGCILADSR | |
| 805.8662 | 3219.4357 | 3219.4917 | -17.4 | 1 | 3 | 2.1 | 1Score > 19 indicates identity |
SALQYKVHYDTTLNGGFATAMALNADATEK + 3 Deamidated (NQ); Oxidation (M) | |
| 427.6943 | 853.3741 | 853.3600 | 16.5 | 0 | 3 | 1.1 | 1Score > 16 indicates identity |
MTSSAGQR + Deamidated (NQ); Oxidation (M) | |
| 400.6820 | 799.3495 | 799.3534 | -4.98 | 0 | 3 | 1.2 | 1Score > 16 indicates identity |
MSTGNFK + Oxidation (M) | |
| 495.2250 | 1482.6531 | 1482.6699 | -11.3 | 1 | 3 | 0.62 | 1Score > 20 indicates identityScore > 13 indicates homology |
NISSSHQDKHSDK + Deamidated (NQ) | |
| 549.2496 | 1644.7269 | 1644.7518 | -15.2 | 1 | 3 | 0.77 | 1Score > 20 indicates identityScore > 14 indicates homology |
EKNELTYGFQSAQK + 3 Deamidated (NQ) | |
| 657.2986 | 1968.8741 | 1968.9099 | -18.2 | 0 | 3 | 0.79 | 1Score > 21 indicates identityScore > 14 indicates homology |
AQQAIQGAATMYGVGVETR + 3 Deamidated (NQ); Oxidation (M) | |
| 954.4337 | 1906.8529 | 1906.8877 | -18.2 | 1 | 3 | 1 | 1Score > 21 indicates identityScore > 15 indicates homology |
EQQLEVMTGCRTGQIR + 2 Deamidated (NQ) | |
| 481.7188 | 961.4231 | 961.4141 | 9.40 | 0 | 3 | 1.9 | 1Score > 18 indicates identity |
NGWENNVK + 2 Deamidated (NQ) | |
| 846.3846 | 2536.1319 | 2536.1316 | 0.14 | 0 | 3 | 0.85 | 1Score > 20 indicates identityScore > 14 indicates homology |
IGIDDQDSYEFLCDFINTVSGK + Deamidated (NQ) | |
| 859.8907 | 1717.7669 | 1717.7941 | -15.8 | 0 | 3 | 2.1 | 1Score > 18 indicates identity |
MHQNSVTLDSAGAITR + 2 Deamidated (NQ); Oxidation (M) | |
| 522.2372 | 2084.9199 | 2084.9109 | 4.29 | 0 | 3 | 2.6 | 1Score > 19 indicates identity |
LDELCQDAAGVNFNGFASR + 2 Deamidated (NQ) | |
| 927.4214 | 1852.8283 | 1852.8486 | -10.9 | 1 | 3 | 0.8 | 1Score > 21 indicates identityScore > 14 indicates homology |
SGQMISAQLQNAHRHR + 4 Deamidated (NQ); Oxidation (M) | |
| 387.1759 | 1158.5058 | 1158.5267 | -18.0 | 0 | 3 | 1.3 | 1Score > 16 indicates identity |
EAYELFMEK | |
| 427.6943 | 1706.7481 | 1706.7756 | -16.1 | 1 | 3 | 1.2 | 1Score > 16 indicates identity |
EEVVGAEMMRHFEK + Oxidation (M) | |
| 400.6820 | 799.3495 | 799.3501 | -0.74 | 0 | 3 | 1.2 | 1Score > 16 indicates identity |
YPDYSR | |
| 630.2864 | 1258.5582 | 1258.5724 | -11.3 | 1 | 3 | 1 | 1Score > 20 indicates identityScore > 15 indicates homology |
TAMGEPGPDGRR + Oxidation (M) | |
| 697.8171 | 2787.2392 | 2787.2408 | -0.57 | 0 | 3 | 2.6 | 1Score > 19 indicates identity |
GFMVLGFPCNQFLEQEPGSDEEIK + Deamidated (NQ); Oxidation (M) | |
| 792.3600 | 3165.4111 | 3165.4068 | 1.35 | 1 | 3 | 0.88 | 1Score > 21 indicates identityScore > 15 indicates homology |
TMVEMMAKGPVEWGALGQWAGFFAMSER + Deamidated (NQ); 3 Oxidation (M) | |
| 805.8662 | 3219.4357 | 3219.4666 | -9.58 | 1 | 3 | 2.2 | 1Score > 19 indicates identity |
TNVDLQIRIMNDENFQHGGTNIHYLEK + 5 Deamidated (NQ); Oxidation (M) | |
| 819.3723 | 1636.7301 | 1636.7120 | 11.1 | 1 | 3 | 1 | 1Score > 21 indicates identityScore > 15 indicates homology |
AMDCADRLMPAQSR + Oxidation (M) | |
| 387.1759 | 772.3372 | 772.3351 | 2.67 | 0 | 3 | 1.3 | 1Score > 16 indicates identity |
AQGEDPR + Deamidated (NQ) | |
| 508.7311 | 2030.8955 | 2030.8979 | -1.19 | 0 | 3 | 1.5 | 1Score > 17 indicates identity |
MSMGHEVVGHWFNEEVK + Oxidation (M) | |
| 724.8293 | 1447.6441 | 1447.6249 | 13.3 | 0 | 3 | 2.1 | 1Score > 18 indicates identity |
ENSMLPEAEQQR + Deamidated (NQ); Oxidation (M) | |
| 900.4092 | 3597.6076 | 3597.5592 | 13.5 | 0 | 3 | 1 | 1Score > 20 indicates identityScore > 15 indicates homology |
DVEAVLSSDSYPFFLDAMYGDMPNNWSPELR + Deamidated (NQ); 2 Oxidation (M) | |
| 927.4214 | 3705.6567 | 3705.6704 | -3.70 | 1 | 3 | 1 | 1Score > 21 indicates identityScore > 15 indicates homology |
DMPYLEQMVQGVKAMGLEACMTLGTLSESQAQR + 2 Deamidated (NQ); 2 Oxidation (M) | |
| 522.2372 | 2084.9199 | 2084.9217 | -0.87 | 0 | 3 | 2.7 | 1Score > 19 indicates identity |
MWMAGQGTIQISDQMNIK + 2 Deamidated (NQ); 2 Oxidation (M) | |
| 603.2741 | 1204.5337 | 1204.5546 | -17.4 | 0 | 3 | 1 | 1Score > 20 indicates identityScore > 15 indicates homology |
HMDYGVQINK + Deamidated (NQ) | |
| 414.1881 | 1652.7235 | 1652.7278 | -2.62 | 1 | 3 | 2.6 | 1Score > 19 indicates identity |
RFNTANDDNVTQVR + 4 Deamidated (NQ) | |
| 508.7311 | 1015.4477 | 1015.4281 | 19.4 | 0 | 3 | 1.5 | 1Score > 17 indicates identity |
YGEQMSTGK + Oxidation (M) | |
| 576.2618 | 1150.5091 | 1150.5288 | -17.1 | 0 | 3 | 0.85 | 1Score > 20 indicates identityScore > 14 indicates homology |
QTQLTEEMR + Oxidation (M) | |
| 427.6943 | 853.3741 | 853.3719 | 2.58 | 0 | 3 | 1.2 | 1Score > 16 indicates identity |
SGDWAYR | |
| 738.3355 | 2211.9847 | 2212.0140 | -13.2 | 1 | 3 | 1 | 1Score > 20 indicates identityScore > 15 indicates homology |
MGRTQLQDAVPMTLGQEFR + 3 Deamidated (NQ); 2 Oxidation (M) | |
| 427.6943 | 853.3741 | 853.3640 | 11.8 | 0 | 3 | 1.2 | 1Score > 16 indicates identity |
GQYPMNK + Deamidated (NQ); Oxidation (M) | |
| 535.7434 | 2138.9445 | 2138.9716 | -12.7 | 1 | 3 | 1.8 | 1Score > 18 indicates identity |
ITGSQVKNNGYVQDTNNQR + 4 Deamidated (NQ) | |
| 738.3355 | 2949.3129 | 2949.2792 | 11.4 | 0 | 3 | 1 | 1Score > 20 indicates identityScore > 15 indicates homology |
AICDEMDIGIDIDLWMDEEPVPMNK + Deamidated (NQ) | |
| 549.2496 | 2192.9692 | 2192.9512 | 8.22 | 1 | 3 | 0.74 | 1Score > 20 indicates identityScore > 14 indicates homology |
RAHFDAGEFVQSWDDDAAR + Deamidated (NQ) | |
| 805.8662 | 3219.4357 | 3219.3835 | 16.2 | 1 | 3 | 2.2 | 1Score > 19 indicates identity |
TQFDLEMMNELGYCSGIENYSRFLSGR + 3 Deamidated (NQ) |
Not what you expected? Try
the select summary.