MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 4 Dec 2025 at 15:28:39 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 801–900 (out of 7566)


Page: Previous 1 4 5 6 7 8 9 10 11 12 13 14  76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2243 562.7557 2246.9936 2246.9606 14.7 0 3 1.9 +1Score > 18 indicates identity HNIEAQHMTIDTNGQMVMK + 2 Deamidated (NQ); 3 Oxidation (M)
2940 616.7802 2463.0917 2463.1051 -5.42 0 3 1.8 +1Score > 18 indicates identity VDGNLNSFELTGQAGADNHFNSR + Deamidated (NQ)
3687 670.8048 1339.5951 1339.6004 -4.02 0 3 2.3 +1Score > 19 indicates identity ESGGDFASVTGGTR
916 454.7066 907.3986 907.3883 11.4 0 3 1.6 +1Score > 17 indicates identity ATSEQSER + Deamidated (NQ)
6297 886.9030 3543.5830 3543.6287 -12.9 1 3 2.3 +1Score > 19 indicates identity QQEMNTQTGRFAADMQVSLVNDGPVTFWLQV + 2 Deamidated (NQ); 2 Oxidation (M)
6320 886.9030 3543.5830 3543.6268 -12.4 0 3 2.3 +1Score > 19 indicates identity WAPLWVIDFPMFEDDGEGGLTAMHHPFTSPK + Oxidation (M)
36 387.1759 1544.6744 1544.6889 -9.41 0 3 1.2 +1Score > 16 indicates identity QAGCTLHEVGTTNR + 2 Deamidated (NQ)
4376 724.8293 2895.2883 2895.3387 -17.4 1 3 1.9 +1Score > 18 indicates identity WCRTNAVDVVLMDMSMPGIGGLEATR + Deamidated (NQ); Oxidation (M)
4442 738.3355 2949.3129 2949.3208 -2.66 0 3 0.68 +1Score > 20 indicates identity
Score > 14 indicates homology
EWAQAGFLNIVGGCCGTTPQHIAAMSR + 2 Deamidated (NQ); Oxidation (M)
4805 765.3478 1528.6810 1528.6688 7.97 1 3 1 +1Score > 21 indicates identity
Score > 15 indicates homology
VTAGNHCDNLRNR + 3 Deamidated (NQ)
6866 927.4214 1852.8283 1852.8375 -4.96 1 3 1 +1Score > 21 indicates identity
Score > 15 indicates homology
GYDVLQYFEMMKEGK + Oxidation (M)
539 427.6943 1706.7481 1706.7576 -5.58 0 3 1.1 +1Score > 16 indicates identity QFDTYNLWNTFTR + 2 Deamidated (NQ)
5398 805.8662 3219.4357 3219.4973 -19.1 1 3 2 +1Score > 19 indicates identity VAMMNRLQQALEHNHFFLMAQPITGMR + 4 Deamidated (NQ); 2 Oxidation (M)
874 454.7066 907.3986 907.3891 10.4 0 3 1.6 +1Score > 17 indicates identity DMAMNQAK
4852 765.3478 3057.3620 3057.4162 -17.7 1 3 1 +1Score > 21 indicates identity
Score > 15 indicates homology
LEPQAEDAPLNNYANERLTQLNQQQR + 5 Deamidated (NQ)
6123 873.3969 2617.1689 2617.1552 5.23 1 3 1 +1Score > 22 indicates identity
Score > 15 indicates homology
NFESVGMGLMETGMAWFWPDRR + Deamidated (NQ)
370 414.1881 1239.5426 1239.5661 -19.0 0 3 2.4 +1Score > 19 indicates identity SPMELMTMLR + 2 Oxidation (M)
3081 630.2864 2517.1164 2517.0722 17.5 1 3 0.74 +1Score > 20 indicates identity
Score > 14 indicates homology
NNYIHDLDMAAERMFTESGMR + Deamidated (NQ); Oxidation (M)
6671 913.9153 1825.8160 1825.8226 -3.62 0 3 2.3 +1Score > 19 indicates identity DIGMPELSDEMLGFTR + Oxidation (M)
7237 954.4337 2860.2793 2860.3185 -13.7 1 3 1 +1Score > 21 indicates identity
Score > 15 indicates homology
TVLGAQSAVKYIVCNADEGDSGTFSDR + Deamidated (NQ)
6934 927.4214 2779.2425 2779.2577 -5.46 1 3 1 +1Score > 21 indicates identity
Score > 15 indicates homology
FSQTMMWIDTVNGLIMVDCASAKK + 2 Deamidated (NQ); 2 Oxidation (M)
1584 508.7311 1015.4477 1015.4611 -13.1 0 3 1.4 +1Score > 17 indicates identity YYDAETVR
3135 630.2864 2517.1164 2517.1189 -1.00 1 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology
KLQLSMDPMLDMMGMQMLMEK + Deamidated (NQ); Oxidation (M)
3752 684.3109 2049.9109 2049.9479 -18.0 1 3 0.83 +1Score > 20 indicates identity
Score > 15 indicates homology
IEHYHDWLRDAHAMEK
4144 711.3232 2841.2639 2841.2570 2.41 1 3 0.64 +1Score > 21 indicates identity
Score > 13 indicates homology
LPPASSSTTSGASNTSSTSQGDIMDQRR + 3 Deamidated (NQ)
7086 940.9276 3759.6811 3759.7468 -17.5 1 3 2.4 +1Score > 19 indicates identity EGHHTSAEDLRDYVMQVIDATAENISSMLQDIR + Oxidation (M)
131 387.1759 1544.6744 1544.6889 -9.41 0 3 1.3 +1Score > 16 indicates identity QAGCTLHEVGTTNR + 2 Deamidated (NQ)
930 454.7066 907.3986 907.4069 -9.16 0 3 1.6 +1Score > 17 indicates identity AALDNMTR + Deamidated (NQ); Oxidation (M)
1913 535.7434 2138.9445 2138.9716 -12.7 1 3 1.7 +1Score > 18 indicates identity ITGSQVKNNGYVQDTNNQR + 4 Deamidated (NQ)
2192 549.2496 1096.4846 1096.4753 8.44 1 3 0.7 +1Score > 20 indicates identity
Score > 14 indicates homology
GDARMMASSR + Oxidation (M)
2260 562.7557 1123.4968 1123.4894 6.60 0 3 1.9 +1Score > 18 indicates identity NLNDTNYNR + Deamidated (NQ)
5782 846.3846 2536.1319 2536.1322 -0.10 0 3 0.64 +1Score > 20 indicates identity
Score > 13 indicates homology
AASMITESQCYQLEQNLHQQR + 2 Deamidated (NQ)
1297 481.7188 1922.8463 1922.8754 -15.1 0 3 1.8 +1Score > 18 indicates identity VSAVLMEQGQMIWQQR + 4 Deamidated (NQ); Oxidation (M)
5823 846.3846 3381.5092 3381.5291 -5.87 0 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology
DGCIAIACPITGDWVAMTNHTWAFSIAEMK + Oxidation (M)
2407 576.2618 1725.7637 1725.7628 0.53 0 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology
SEQNNTEMTFQIQR + Deamidated (NQ)
6630 913.9153 3651.6320 3651.6920 -16.4 1 3 2.3 +1Score > 19 indicates identity NVMLGGGDNALMLPEQASNIRLQSSETPQEIFR + 5 Deamidated (NQ); 2 Oxidation (M)
6834 927.4214 2779.2425 2779.2945 -18.7 0 3 1 +1Score > 21 indicates identity
Score > 15 indicates homology
GMNLVGYDAMAIGNHEFDNPLTVLR + Deamidated (NQ); 2 Oxidation (M)
956 454.7066 907.3986 907.4069 -9.16 0 3 1.6 +1Score > 17 indicates identity AALDNMTR + Deamidated (NQ); Oxidation (M)
1095 468.2127 934.4109 934.4192 -8.88 0 3 0.6 +1Score > 20 indicates identity
Score > 13 indicates homology
HHSPACAR
3099 630.2864 1887.8373 1887.8172 10.7 1 3 0.64 +1Score > 20 indicates identity
Score > 13 indicates homology
DTPFFSGYKMTYMQR + Deamidated (NQ); Oxidation (M)
3268 643.7925 2571.1411 2571.1547 -5.30 1 3 2 +1Score > 18 indicates identity AHFSYSDSAEMLSGNSDLNEKLR + Deamidated (NQ)
3452 657.2986 1968.8741 1968.9098 -18.1 1 3 1 +1Score > 21 indicates identity
Score > 15 indicates homology
GEAGQQVNIKIMEYSER + 2 Deamidated (NQ); Oxidation (M)
7192 954.4337 1906.8529 1906.8513 0.82 1 3 0.79 +1Score > 21 indicates identity
Score > 14 indicates homology
DDVNEVRNGMECGIGVK + Oxidation (M)
2418 576.2618 1725.7637 1725.7668 -1.83 1 3 0.98 +1Score > 20 indicates identity
Score > 15 indicates homology
FETDKWDVMDADVR
3273 643.7925 2571.1411 2571.1880 -18.2 1 3 2 +1Score > 18 indicates identity HDSSVTGIMMSLCSERFVSSLGR + Oxidation (M)
4206 711.3232 2841.2639 2841.3174 -18.8 0 3 1 +1Score > 21 indicates identity
Score > 15 indicates homology
MASENMTPQDYIGHHLNNLQLDLR + 2 Oxidation (M)
4790 765.3478 3057.3620 3057.3405 7.02 1 3 0.85 +1Score > 21 indicates identity
Score > 15 indicates homology
ECEEMMIKLFGEPVAFDEEQPQQTR + Deamidated (NQ); Oxidation (M)
5470 819.3723 2455.0951 2455.1060 -4.45 0 3 0.58 +1Score > 21 indicates identity
Score > 13 indicates homology
NAGDFNLNMNSGSETAVDSIVGLK + 3 Deamidated (NQ)
1441 495.2250 1976.8708 1976.8996 -14.6 0 3 0.78 +1Score > 20 indicates identity
Score > 14 indicates homology
AASEEVINMLSQANPQTR + 3 Deamidated (NQ); Oxidation (M)
2058 549.2496 2192.9692 2192.9500 8.75 1 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology
MHGNSEMQKINQTSAMPEK + Deamidated (NQ); 2 Oxidation (M)
1603 508.7311 1015.4477 1015.4458 1.91 0 3 1.4 +1Score > 17 indicates identity GNNQPDIQK + 3 Deamidated (NQ)
393 414.1881 1652.7235 1652.7278 -2.62 1 3 2.5 +1Score > 19 indicates identity RFNTANDDNVTQVR + 4 Deamidated (NQ)
4652 751.8416 3003.3374 3003.3403 -1.00 0 3 2.3 +1Score > 19 indicates identity QEPYENVTLDVEEQHQGSVMQALGER + 2 Deamidated (NQ); Oxidation (M)
491 414.1881 1239.5426 1239.5553 -10.3 1 3 2.5 +1Score > 19 indicates identity QKMAENNGGYK + Deamidated (NQ)
1605 508.7311 1015.4477 1015.4458 1.91 0 3 1.4 +1Score > 17 indicates identity GNNQPDIQK + 3 Deamidated (NQ)
3126 630.2864 2517.1164 2517.1239 -2.99 1 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology
LYDRGSNGFWPGEGCGMVVLMR + Deamidated (NQ); Oxidation (M)
5078 778.8539 1555.6932 1555.7049 -7.52 1 3 2 +1Score > 18 indicates identity SSMTLGAGGSSPSHKH + Oxidation (M)
6177 873.3969 3489.5585 3489.5641 -1.58 1 3 1 +1Score > 22 indicates identity
Score > 15 indicates homology
NIAMVFQNYALYPHMTVYDNMAFGLKMQK + 4 Deamidated (NQ); 3 Oxidation (M)
448 414.1881 826.3617 826.3677 -7.23 0 3 2.5 +1Score > 19 indicates identity MATVSMR + 2 Oxidation (M)
3607 670.8048 2679.1901 2679.1983 -3.06 1 3 2.5 +1Score > 19 indicates identity TQLDSAGYRHVDQVMEHGEYATR + Deamidated (NQ); Oxidation (M)
5134 792.3600 2374.0583 2374.0755 -7.25 1 3 0.59 +1Score > 21 indicates identity
Score > 13 indicates homology
CVNEGKPNEYNLYRMMIDK + Deamidated (NQ)
5759 832.8785 3327.4848 3327.5162 -9.44 1 3 2.5 +1Score > 19 indicates identity IDTNQCIDSKNIDIYTPEQIIAMGWQNK + 4 Deamidated (NQ); Oxidation (M)
2477 576.2618 1150.5091 1150.5111 -1.68 0 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology
MEGCILADSR
5321 805.8662 3219.4357 3219.4917 -17.4 1 3 2.1 +1Score > 19 indicates identity SALQYKVHYDTTLNGGFATAMALNADATEK + 3 Deamidated (NQ); Oxidation (M)
664 427.6943 853.3741 853.3600 16.5 0 3 1.1 +1Score > 16 indicates identity MTSSAGQR + Deamidated (NQ); Oxidation (M)
216 400.6820 799.3495 799.3534 -4.98 0 3 1.2 +1Score > 16 indicates identity MSTGNFK + Oxidation (M)
1474 495.2250 1482.6531 1482.6699 -11.3 1 3 0.62 +1Score > 20 indicates identity
Score > 13 indicates homology
NISSSHQDKHSDK + Deamidated (NQ)
2075 549.2496 1644.7269 1644.7518 -15.2 1 3 0.77 +1Score > 20 indicates identity
Score > 14 indicates homology
EKNELTYGFQSAQK + 3 Deamidated (NQ)
3483 657.2986 1968.8741 1968.9099 -18.2 0 3 0.79 +1Score > 21 indicates identity
Score > 14 indicates homology
AQQAIQGAATMYGVGVETR + 3 Deamidated (NQ); Oxidation (M)
7146 954.4337 1906.8529 1906.8877 -18.2 1 3 1 +1Score > 21 indicates identity
Score > 15 indicates homology
EQQLEVMTGCRTGQIR + 2 Deamidated (NQ)
1308 481.7188 961.4231 961.4141 9.40 0 3 1.9 +1Score > 18 indicates identity NGWENNVK + 2 Deamidated (NQ)
5798 846.3846 2536.1319 2536.1316 0.14 0 3 0.85 +1Score > 20 indicates identity
Score > 14 indicates homology
IGIDDQDSYEFLCDFINTVSGK + Deamidated (NQ)
6042 859.8907 1717.7669 1717.7941 -15.8 0 3 2.1 +1Score > 18 indicates identity MHQNSVTLDSAGAITR + 2 Deamidated (NQ); Oxidation (M)
1789 522.2372 2084.9199 2084.9109 4.29 0 3 2.6 +1Score > 19 indicates identity LDELCQDAAGVNFNGFASR + 2 Deamidated (NQ)
6843 927.4214 1852.8283 1852.8486 -10.9 1 3 0.8 +1Score > 21 indicates identity
Score > 14 indicates homology
SGQMISAQLQNAHRHR + 4 Deamidated (NQ); Oxidation (M)
79 387.1759 1158.5058 1158.5267 -18.0 0 3 1.3 +1Score > 16 indicates identity EAYELFMEK
637 427.6943 1706.7481 1706.7756 -16.1 1 3 1.2 +1Score > 16 indicates identity EEVVGAEMMRHFEK + Oxidation (M)
206 400.6820 799.3495 799.3501 -0.74 0 3 1.2 +1Score > 16 indicates identity YPDYSR
3106 630.2864 1258.5582 1258.5724 -11.3 1 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology
TAMGEPGPDGRR + Oxidation (M)
3918 697.8171 2787.2392 2787.2408 -0.57 0 3 2.6 +1Score > 19 indicates identity GFMVLGFPCNQFLEQEPGSDEEIK + Deamidated (NQ); Oxidation (M)
5138 792.3600 3165.4111 3165.4068 1.35 1 3 0.88 +1Score > 21 indicates identity
Score > 15 indicates homology
TMVEMMAKGPVEWGALGQWAGFFAMSER + Deamidated (NQ); 3 Oxidation (M)
5309 805.8662 3219.4357 3219.4666 -9.58 1 3 2.2 +1Score > 19 indicates identity TNVDLQIRIMNDENFQHGGTNIHYLEK + 5 Deamidated (NQ); Oxidation (M)
5526 819.3723 1636.7301 1636.7120 11.1 1 3 1 +1Score > 21 indicates identity
Score > 15 indicates homology
AMDCADRLMPAQSR + Oxidation (M)
59 387.1759 772.3372 772.3351 2.67 0 3 1.3 +1Score > 16 indicates identity AQGEDPR + Deamidated (NQ)
1645 508.7311 2030.8955 2030.8979 -1.19 0 3 1.5 +1Score > 17 indicates identity MSMGHEVVGHWFNEEVK + Oxidation (M)
4366 724.8293 1447.6441 1447.6249 13.3 0 3 2.1 +1Score > 18 indicates identity ENSMLPEAEQQR + Deamidated (NQ); Oxidation (M)
6505 900.4092 3597.6076 3597.5592 13.5 0 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology
DVEAVLSSDSYPFFLDAMYGDMPNNWSPELR + Deamidated (NQ); 2 Oxidation (M)
6832 927.4214 3705.6567 3705.6704 -3.70 1 3 1 +1Score > 21 indicates identity
Score > 15 indicates homology
DMPYLEQMVQGVKAMGLEACMTLGTLSESQAQR + 2 Deamidated (NQ); 2 Oxidation (M)
1747 522.2372 2084.9199 2084.9217 -0.87 0 3 2.7 +1Score > 19 indicates identity MWMAGQGTIQISDQMNIK + 2 Deamidated (NQ); 2 Oxidation (M)
2850 603.2741 1204.5337 1204.5546 -17.4 0 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology
HMDYGVQINK + Deamidated (NQ)
413 414.1881 1652.7235 1652.7278 -2.62 1 3 2.6 +1Score > 19 indicates identity RFNTANDDNVTQVR + 4 Deamidated (NQ)
1641 508.7311 1015.4477 1015.4281 19.4 0 3 1.5 +1Score > 17 indicates identity YGEQMSTGK + Oxidation (M)
2435 576.2618 1150.5091 1150.5288 -17.1 0 3 0.85 +1Score > 20 indicates identity
Score > 14 indicates homology
QTQLTEEMR + Oxidation (M)
566 427.6943 853.3741 853.3719 2.58 0 3 1.2 +1Score > 16 indicates identity SGDWAYR
4457 738.3355 2211.9847 2212.0140 -13.2 1 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology
MGRTQLQDAVPMTLGQEFR + 3 Deamidated (NQ); 2 Oxidation (M)
607 427.6943 853.3741 853.3640 11.8 0 3 1.2 +1Score > 16 indicates identity GQYPMNK + Deamidated (NQ); Oxidation (M)
2014 535.7434 2138.9445 2138.9716 -12.7 1 3 1.8 +1Score > 18 indicates identity ITGSQVKNNGYVQDTNNQR + 4 Deamidated (NQ)
4445 738.3355 2949.3129 2949.2792 11.4 0 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology
AICDEMDIGIDIDLWMDEEPVPMNK + Deamidated (NQ)
2095 549.2496 2192.9692 2192.9512 8.22 1 3 0.74 +1Score > 20 indicates identity
Score > 14 indicates homology
RAHFDAGEFVQSWDDDAAR + Deamidated (NQ)
5281 805.8662 3219.4357 3219.3835 16.2 1 3 2.2 +1Score > 19 indicates identity TQFDLEMMNELGYCSGIENYSRFLSGR + 3 Deamidated (NQ)
Page: Previous 1 4 5 6 7 8 9 10 11 12 13 14  76 Next 

Not what you expected? Try the select summary.