MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 4 Dec 2025 at 15:28:39 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 701–800 (out of 7566)


Page: Previous 1 3 4 5 6 7 8 9 10 11 12 13  76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3140 630.2864 1258.5582 1258.5724 -11.3 1 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
VNDRSHQMEK + Oxidation (M)
1620 508.7311 2030.8955 2030.9037 -4.05 1 3 1.3 +1Score > 17 indicates identity HGNSEMQKINQTSAMPEK + 2 Deamidated (NQ)
280 400.6820 1598.6989 1598.7186 -12.3 1 3 1 +1Score > 16 indicates identity GGQHSGGNFKNDPQR + Deamidated (NQ)
2632 589.7679 2355.0427 2355.0511 -3.59 0 3 2 +1Score > 19 indicates identity INQMCAQFNSDEITTFHAVK + 2 Deamidated (NQ)
4131 711.3232 1420.6319 1420.6066 17.8 1 3 0.79 +1Score > 21 indicates identity
Score > 15 indicates homology
DEQKNESAQDTR + Deamidated (NQ)
4267 724.8293 2895.2883 2895.3208 -11.2 0 3 1.7 +1Score > 18 indicates identity SWGVTVLQANGEMDAGPVWASATFPMR + 2 Deamidated (NQ); Oxidation (M)
1861 522.2372 2084.9199 2084.9287 -4.22 0 3 2.2 +1Score > 19 indicates identity QTSLNGFYQDNGGDADLLR + 2 Deamidated (NQ)
4018 697.8171 1393.6196 1393.6031 11.9 0 3 2.2 +1Score > 19 indicates identity TEQVNQQLMER + 3 Deamidated (NQ); Oxidation (M)
49 387.1759 772.3372 772.3351 2.67 0 3 1.1 +1Score > 16 indicates identity AQGEDPR + Deamidated (NQ)
928 454.7066 1814.7972 1814.7853 6.53 0 3 1.4 +1Score > 17 indicates identity SHQHTTQTSGQGMLER + 2 Deamidated (NQ); Oxidation (M)
2789 603.2741 2409.0673 2409.0689 -0.64 0 3 0.77 +1Score > 20 indicates identity
Score > 15 indicates homology
HSTNAVQIMGALGCNDNYSISR + 2 Deamidated (NQ)
4349 724.8293 2895.2883 2895.3457 -19.8 1 3 1.7 +1Score > 18 indicates identity YSNDLPQAEMTARELAYNAPGNQGLR + Deamidated (NQ); Oxidation (M)
4536 738.3355 2949.3129 2949.3702 -19.4 0 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
EFQQLDFSSLHLSAGGGMPVQQVVAER + 4 Deamidated (NQ); Oxidation (M)
383 414.1881 1652.7235 1652.7253 -1.09 0 3 2.2 +1Score > 19 indicates identity CWQEEAYAEAQLR
466 414.1881 1652.7235 1652.7253 -1.09 0 3 2.2 +1Score > 19 indicates identity CWQEEAYAEAQLR
2221 562.7557 1123.4968 1123.5067 -8.80 0 3 1.7 +1Score > 18 indicates identity QQETAVATMK + 2 Deamidated (NQ); Oxidation (M)
4093 711.3232 2841.2639 2841.3003 -12.8 1 3 0.5 +1Score > 21 indicates identity
Score > 13 indicates homology
AKNGDNEYMAWDMTLGWIIWQQR + Oxidation (M)
1428 495.2250 1976.8708 1976.8828 -6.08 0 3 0.98 +1Score > 20 indicates identity
Score > 16 indicates homology
GCMGVDIGSAMTYMLLAR + 2 Oxidation (M)
3889 684.3109 2733.2145 2733.2399 -9.26 1 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
CQNSKLEAAVTQAEQQGEVALNDAR + 4 Deamidated (NQ)
4491 738.3355 1474.6565 1474.6582 -1.21 1 3 0.52 +1Score > 20 indicates identity
Score > 13 indicates homology
AECQNQQGNLRR + 2 Deamidated (NQ)
7603 980.1954 2937.5645 2937.5382 8.94 1 3 1.7 +1Score > 18 indicates identity FSIALLNQAVERVHTAIVVQDPTMQR + 2 Deamidated (NQ)
4193 711.3232 1420.6319 1420.6542 -15.7 1 3 1 +1Score > 21 indicates identity
Score > 16 indicates homology
SKQQNQQTSSER + Deamidated (NQ)
4433 738.3355 2949.3129 2949.2792 11.4 0 3 0.52 +1Score > 20 indicates identity
Score > 13 indicates homology
AICDEMDIGIDIDLWMDEEPVPMNK + Deamidated (NQ)
2029 535.7434 1069.4723 1069.4750 -2.55 0 3 1.5 +1Score > 18 indicates identity EYEMEVVR + Oxidation (M)
949 454.7066 1814.7972 1814.7678 16.2 0 3 1.5 +1Score > 17 indicates identity VYMWVGMMPDSDPQK + 2 Oxidation (M)
1451 495.2250 1976.8708 1976.8806 -4.93 1 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
KQWSWGHSEFGQAWDK + Deamidated (NQ)
4305 724.8293 2895.2883 2895.3387 -17.4 1 3 1.8 +1Score > 18 indicates identity WCRTNAVDVVLMDMSMPGIGGLEATR + Deamidated (NQ); Oxidation (M)
5694 832.8785 1663.7424 1663.7559 -8.10 1 3 2.2 +1Score > 19 indicates identity FSLCLAHCTDERR
6146 873.3969 3489.5585 3489.5641 -1.58 1 3 0.55 +1Score > 22 indicates identity
Score > 13 indicates homology
NIAMVFQNYALYPHMTVYDNMAFGLKMQK + 4 Deamidated (NQ); 3 Oxidation (M)
3797 684.3109 2733.2145 2733.2577 -15.8 0 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
NQGTAQNIQLELQDDSGNTLNTGATK + 3 Deamidated (NQ)
5156 792.3600 1582.7055 1582.7045 0.64 1 3 0.99 +1Score > 21 indicates identity
Score > 16 indicates homology
CQYETLVENNRR + 2 Deamidated (NQ)
7496 980.1954 2937.5645 2937.5117 18.0 0 3 1.8 +1Score > 18 indicates identity AATIAHVQQNAAVLEVELSSAELAMLDK + Oxidation (M)
1885 535.7434 2138.9445 2138.9716 -12.7 1 3 1.5 +1Score > 18 indicates identity ITGSQVKNNGYVQDTNNQR + 4 Deamidated (NQ)
3610 670.8048 1339.5951 1339.6190 -17.9 1 3 2.2 +1Score > 19 indicates identity KDSGFQMNQLR + Deamidated (NQ); Oxidation (M)
2450 576.2618 2301.0183 2300.9751 18.7 0 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
MSAIENFDAHTPMMQQYLR + 3 Deamidated (NQ); Oxidation (M)
2771 603.2741 1806.8005 1806.7989 0.91 0 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
QQMLPNTNGGMLNSNR + Deamidated (NQ); 2 Oxidation (M)
645 427.6943 853.3741 853.3600 16.5 0 3 1 +1Score > 16 indicates identity MTSSAGQR + Deamidated (NQ); Oxidation (M)
1935 535.7434 2138.9445 2138.9765 -14.9 0 3 1.5 +1Score > 18 indicates identity EIFTAMGIDFHLNCEIGR + Deamidated (NQ); Oxidation (M)
6303 886.9030 1771.7915 1771.8233 -18.0 1 3 2.2 +1Score > 19 indicates identity MGDTAEQMAKTYGITR
1497 495.2250 1482.6531 1482.6443 5.96 1 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
MSGDNGMTEEKLR + Oxidation (M)
3759 684.3109 1366.6073 1366.6187 -8.36 0 3 0.77 +1Score > 20 indicates identity
Score > 15 indicates homology
EQTAWLSGTMAR + Deamidated (NQ); Oxidation (M)
4431 738.3355 2949.3129 2949.2792 11.4 0 3 0.5 +1Score > 20 indicates identity
Score > 13 indicates homology
AICDEMDIGIDIDLWMDEEPVPMNK + Deamidated (NQ)
4774 765.3478 2293.0215 2293.0467 -11.0 1 3 0.8 +1Score > 21 indicates identity
Score > 15 indicates homology
RYYNTAGSMMTEAAIDGGITR + Oxidation (M)
6455 900.4092 1798.8038 1798.7971 3.74 0 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
VIYSTYESNETMYAK + Deamidated (NQ)
7533 980.1954 3916.7526 3916.7167 9.17 1 3 1.8 +1Score > 18 indicates identity DGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNK + 7 Deamidated (NQ); Oxidation (M)
1757 522.2372 1042.4599 1042.4576 2.26 0 3 2.3 +1Score > 19 indicates identity GFADAIMMR + 2 Oxidation (M)
3489 657.2986 2625.1655 2625.1720 -2.49 1 3 0.54 +1Score > 21 indicates identity
Score > 13 indicates homology
VMQVSAMADQMLLDSKNPQSAGNR + 3 Deamidated (NQ); 2 Oxidation (M)
4690 751.8416 3003.3374 3003.3832 -15.3 0 3 2.1 +1Score > 19 indicates identity AQNSNLNSDQLVTLQVSNSGDQPLWLR + 7 Deamidated (NQ)
1761 522.2372 2084.9199 2084.9296 -4.66 0 3 2.3 +1Score > 19 indicates identity EHVATGIDCYMQQFGVSK + Oxidation (M)
151 387.1759 1544.6744 1544.7003 -16.8 0 3 1.2 +1Score > 16 indicates identity LYPFEMSGGMLQR + Deamidated (NQ); Oxidation (M)
410 414.1881 1652.7235 1652.7385 -9.12 0 3 2.3 +1Score > 19 indicates identity AMMDNLQTETVINR + 2 Deamidated (NQ); Oxidation (M)
6920 927.4214 2779.2425 2779.2577 -5.46 1 3 1 +1Score > 21 indicates identity
Score > 16 indicates homology
FSQTMMWIDTVNGLIMVDCASAKK + 2 Deamidated (NQ); 2 Oxidation (M)
7260 954.4337 1906.8529 1906.8796 -14.0 0 3 1 +1Score > 21 indicates identity
Score > 16 indicates homology
QDIADYVASNIQDPLSR + 3 Deamidated (NQ)
601 427.6943 1706.7481 1706.7756 -16.1 1 3 1 +1Score > 16 indicates identity EEVVGAEMMRHFEK + Oxidation (M)
978 454.7066 1814.7972 1814.8100 -7.07 0 3 1.5 +1Score > 17 indicates identity VMQVSAMADQMLLDSK + Deamidated (NQ); 3 Oxidation (M)
3441 657.2986 1968.8741 1968.8849 -5.48 0 3 1 +1Score > 21 indicates identity
Score > 16 indicates homology
GVEAVMYMGTLSYEQFK + Deamidated (NQ); Oxidation (M)
5512 819.3723 2455.0951 2455.1399 -18.3 0 3 0.58 +1Score > 21 indicates identity
Score > 13 indicates homology
IPTWIMQGYATLADEAVEQMR + Deamidated (NQ); 2 Oxidation (M)
7517 980.1954 3916.7526 3916.7167 9.17 1 3 1.8 +1Score > 18 indicates identity DGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNK + 7 Deamidated (NQ); Oxidation (M)
881 454.7066 907.3986 907.4069 -9.16 0 3 1.5 +1Score > 17 indicates identity AALDNMTR + Deamidated (NQ); Oxidation (M)
1142 468.2127 1401.6163 1401.6419 -18.3 1 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
MQTNPQNQQRR + 2 Deamidated (NQ)
1155 468.2127 934.4109 934.4066 4.58 0 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
MTPQESDK
2132 549.2496 1096.4846 1096.4893 -4.25 0 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
DEMIMSAIR + 2 Oxidation (M)
2259 562.7557 1123.4968 1123.5179 -18.8 0 3 1.8 +1Score > 18 indicates identity SASLSDIEMR + Oxidation (M)
3919 697.8171 2787.2392 2787.2408 -0.57 0 3 2.3 +1Score > 19 indicates identity GFMVLGFPCNQFLEQEPGSDEEIK + Deamidated (NQ); Oxidation (M)
1865 522.2372 1563.6899 1563.7126 -14.5 0 3 2.4 +1Score > 19 indicates identity NAMLPLENSDSPFK + 2 Deamidated (NQ)
2264 562.7557 1123.4968 1123.5033 -5.78 1 3 1.8 +1Score > 18 indicates identity DKNFDNIQK + 3 Deamidated (NQ)
2320 562.7557 2246.9936 2247.0253 -14.1 1 3 1.8 +1Score > 18 indicates identity VKMDVYDLFVNSDLDSADGK + Deamidated (NQ); Oxidation (M)
361 414.1881 1652.7235 1652.7529 -17.8 0 3 2.3 +1Score > 19 indicates identity EQDNIAIVTYAGDSR + 2 Deamidated (NQ)
5458 819.3723 1636.7301 1636.7185 7.07 0 3 0.56 +1Score > 21 indicates identity
Score > 13 indicates homology
VGGLSVMCEDAEAAGR + Oxidation (M)
1416 495.2250 1482.6531 1482.6806 -18.6 0 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
MVNSGTEATMSAIR + Oxidation (M)
5224 792.3600 2374.0583 2374.0423 6.75 0 3 1 +1Score > 21 indicates identity
Score > 16 indicates homology
IEYVGNGYINEAQNMGWLQR + 4 Deamidated (NQ); Oxidation (M)
23 387.1759 1544.6744 1544.6889 -9.41 0 3 1.2 +1Score > 16 indicates identity QAGCTLHEVGTTNR + 2 Deamidated (NQ)
2198 549.2496 1096.4846 1096.4794 4.76 0 3 0.74 +1Score > 20 indicates identity
Score > 14 indicates homology
CCISAAPYR
2254 562.7557 1123.4968 1123.5179 -18.8 0 3 1.8 +1Score > 18 indicates identity SASLSDIEMR + Oxidation (M)
6111 873.3969 1744.7793 1744.8097 -17.4 1 3 1 +1Score > 22 indicates identity
Score > 16 indicates homology
MSHIQRETSCSRPR + Deamidated (NQ)
6820 927.4214 2779.2425 2779.2541 -4.17 1 3 1 +1Score > 21 indicates identity
Score > 16 indicates homology
DLMQQARHEQPPVNVSELETMHR + 3 Deamidated (NQ); 2 Oxidation (M)
2842 603.2741 1806.8005 1806.8054 -2.70 1 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
VSNQQDDMTKNAQAEK + Deamidated (NQ)
1486 495.2250 1482.6531 1482.6474 3.81 0 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
DLETQSQDGTFDK
4870 765.3478 3057.3620 3057.3702 -2.67 1 3 1 +1Score > 21 indicates identity
Score > 16 indicates homology
VTPDMEFAQQFFADLHNNFQKAAAANK + 5 Deamidated (NQ)
6149 873.3969 3489.5585 3489.5181 11.6 1 3 0.97 +1Score > 22 indicates identity
Score > 15 indicates homology
SDVVNYVSENLKDYLQTMGYSGNDEEFIEK + 4 Deamidated (NQ)
6642 913.9153 1825.8160 1825.8087 4.01 1 3 2.2 +1Score > 19 indicates identity NGMECGIGVKNYNDVR + Deamidated (NQ)
922 454.7066 907.3986 907.3817 18.6 1 3 1.6 +1Score > 17 indicates identity ENMGRER + Deamidated (NQ); Oxidation (M)
3440 657.2986 2625.1655 2625.1397 9.83 1 3 0.98 +1Score > 21 indicates identity
Score > 16 indicates homology
VDQEYEGIVRQLMTYMMEDSR + Deamidated (NQ); 2 Oxidation (M)
6184 873.3969 3489.5585 3489.6244 -18.9 1 3 1 +1Score > 22 indicates identity
Score > 16 indicates homology
AQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQK + 2 Deamidated (NQ)
232 400.6820 1598.6989 1598.6990 -0.051 0 3 1.1 +1Score > 16 indicates identity SDVTPALSEMMQMK + 2 Oxidation (M)
446 414.1881 1239.5426 1239.5376 4.01 0 3 2.3 +1Score > 19 indicates identity SVMDNMWLGR + 2 Oxidation (M)
2336 562.7557 1123.4968 1123.4824 12.8 1 3 1.9 +1Score > 18 indicates identity RQMMGMEPK + Deamidated (NQ); Oxidation (M)
2751 603.2741 1204.5337 1204.5546 -17.4 0 3 0.54 +1Score > 20 indicates identity
Score > 13 indicates homology
HMDYGVQINK + Deamidated (NQ)
2918 616.7802 2463.0917 2463.0987 -2.84 1 3 1.8 +1Score > 18 indicates identity GKVMLFGHWDNECEIPDPYR + Deamidated (NQ)
5442 819.3723 2455.0951 2455.0815 5.54 1 3 1 +1Score > 21 indicates identity
Score > 16 indicates homology
QSAFSEEWDEWETLLDANKR + 2 Deamidated (NQ)
582 427.6943 853.3741 853.3600 16.5 0 3 1.1 +1Score > 16 indicates identity MTSSAGQR + Deamidated (NQ); Oxidation (M)
3094 630.2864 1887.8373 1887.8461 -4.68 0 3 0.89 +1Score > 20 indicates identity
Score > 15 indicates homology
AQAAQPDQLMSDYFFR + Deamidated (NQ)
6133 873.3969 2617.1689 2617.2040 -13.4 0 3 0.58 +1Score > 22 indicates identity
Score > 13 indicates homology
VECLELDNLMETAYATAVSANFR + Deamidated (NQ)
6980 940.9276 3759.6811 3759.6935 -3.30 0 3 2.3 +1Score > 19 indicates identity LMIALEMIGYYDSAPGSQNYPYPAMSWLYPDR + 3 Oxidation (M)
1377 495.2250 1976.8708 1976.8356 17.8 0 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
GWGMQSHDSSVMQLQQR + 3 Deamidated (NQ)
3086 630.2864 1258.5582 1258.5724 -11.3 1 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
TAMGEPGPDGRR + Oxidation (M)
5581 819.3723 2455.0951 2455.1399 -18.3 0 3 1 +1Score > 21 indicates identity
Score > 16 indicates homology
IPTWIMQGYATLADEAVEQMR + Deamidated (NQ); 2 Oxidation (M)
5606 832.8785 1663.7424 1663.7359 3.91 0 3 2.3 +1Score > 19 indicates identity AMEDQIINDLNDTR + Deamidated (NQ); Oxidation (M)
6382 886.9030 3543.5830 3543.6287 -12.9 1 3 2.3 +1Score > 19 indicates identity QQEMNTQTGRFAADMQVSLVNDGPVTFWLQV + 2 Deamidated (NQ); 2 Oxidation (M)
1765 522.2372 2084.9199 2084.9322 -5.92 0 3 2.4 +1Score > 19 indicates identity VQIEPLYNQEQFDVVMM + 3 Deamidated (NQ)
Page: Previous 1 3 4 5 6 7 8 9 10 11 12 13  76 Next 

Not what you expected? Try the select summary.