| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | test |
| MS data file | : | PRT1346_ENIGMA_14.mgf |
| Database | : | Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues) |
| Timestamp | : | 4 Dec 2025 at 15:28:39 GMT |
Not what you expected? Try
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | |
| Variable modifications | : | |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 7,621 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 | 2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | ||||
| 6.2e-007 | 1 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | ||||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle (
) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 630.2864 | 1258.5582 | 1258.5724 | -11.3 | 1 | 3 | 1 | 1Score > 20 indicates identityScore > 16 indicates homology |
VNDRSHQMEK + Oxidation (M) | |
| 508.7311 | 2030.8955 | 2030.9037 | -4.05 | 1 | 3 | 1.3 | 1Score > 17 indicates identity |
HGNSEMQKINQTSAMPEK + 2 Deamidated (NQ) | |
| 400.6820 | 1598.6989 | 1598.7186 | -12.3 | 1 | 3 | 1 | 1Score > 16 indicates identity |
GGQHSGGNFKNDPQR + Deamidated (NQ) | |
| 589.7679 | 2355.0427 | 2355.0511 | -3.59 | 0 | 3 | 2 | 1Score > 19 indicates identity |
INQMCAQFNSDEITTFHAVK + 2 Deamidated (NQ) | |
| 711.3232 | 1420.6319 | 1420.6066 | 17.8 | 1 | 3 | 0.79 | 1Score > 21 indicates identityScore > 15 indicates homology |
DEQKNESAQDTR + Deamidated (NQ) | |
| 724.8293 | 2895.2883 | 2895.3208 | -11.2 | 0 | 3 | 1.7 | 1Score > 18 indicates identity |
SWGVTVLQANGEMDAGPVWASATFPMR + 2 Deamidated (NQ); Oxidation (M) | |
| 522.2372 | 2084.9199 | 2084.9287 | -4.22 | 0 | 3 | 2.2 | 1Score > 19 indicates identity |
QTSLNGFYQDNGGDADLLR + 2 Deamidated (NQ) | |
| 697.8171 | 1393.6196 | 1393.6031 | 11.9 | 0 | 3 | 2.2 | 1Score > 19 indicates identity |
TEQVNQQLMER + 3 Deamidated (NQ); Oxidation (M) | |
| 387.1759 | 772.3372 | 772.3351 | 2.67 | 0 | 3 | 1.1 | 1Score > 16 indicates identity |
AQGEDPR + Deamidated (NQ) | |
| 454.7066 | 1814.7972 | 1814.7853 | 6.53 | 0 | 3 | 1.4 | 1Score > 17 indicates identity |
SHQHTTQTSGQGMLER + 2 Deamidated (NQ); Oxidation (M) | |
| 603.2741 | 2409.0673 | 2409.0689 | -0.64 | 0 | 3 | 0.77 | 1Score > 20 indicates identityScore > 15 indicates homology |
HSTNAVQIMGALGCNDNYSISR + 2 Deamidated (NQ) | |
| 724.8293 | 2895.2883 | 2895.3457 | -19.8 | 1 | 3 | 1.7 | 1Score > 18 indicates identity |
YSNDLPQAEMTARELAYNAPGNQGLR + Deamidated (NQ); Oxidation (M) | |
| 738.3355 | 2949.3129 | 2949.3702 | -19.4 | 0 | 3 | 1 | 1Score > 20 indicates identityScore > 16 indicates homology |
EFQQLDFSSLHLSAGGGMPVQQVVAER + 4 Deamidated (NQ); Oxidation (M) | |
| 414.1881 | 1652.7235 | 1652.7253 | -1.09 | 0 | 3 | 2.2 | 1Score > 19 indicates identity |
CWQEEAYAEAQLR | |
| 414.1881 | 1652.7235 | 1652.7253 | -1.09 | 0 | 3 | 2.2 | 1Score > 19 indicates identity |
CWQEEAYAEAQLR | |
| 562.7557 | 1123.4968 | 1123.5067 | -8.80 | 0 | 3 | 1.7 | 1Score > 18 indicates identity |
QQETAVATMK + 2 Deamidated (NQ); Oxidation (M) | |
| 711.3232 | 2841.2639 | 2841.3003 | -12.8 | 1 | 3 | 0.5 | 1Score > 21 indicates identityScore > 13 indicates homology |
AKNGDNEYMAWDMTLGWIIWQQR + Oxidation (M) | |
| 495.2250 | 1976.8708 | 1976.8828 | -6.08 | 0 | 3 | 0.98 | 1Score > 20 indicates identityScore > 16 indicates homology |
GCMGVDIGSAMTYMLLAR + 2 Oxidation (M) | |
| 684.3109 | 2733.2145 | 2733.2399 | -9.26 | 1 | 3 | 1 | 1Score > 20 indicates identityScore > 16 indicates homology |
CQNSKLEAAVTQAEQQGEVALNDAR + 4 Deamidated (NQ) | |
| 738.3355 | 1474.6565 | 1474.6582 | -1.21 | 1 | 3 | 0.52 | 1Score > 20 indicates identityScore > 13 indicates homology |
AECQNQQGNLRR + 2 Deamidated (NQ) | |
| 980.1954 | 2937.5645 | 2937.5382 | 8.94 | 1 | 3 | 1.7 | 1Score > 18 indicates identity |
FSIALLNQAVERVHTAIVVQDPTMQR + 2 Deamidated (NQ) | |
| 711.3232 | 1420.6319 | 1420.6542 | -15.7 | 1 | 3 | 1 | 1Score > 21 indicates identityScore > 16 indicates homology |
SKQQNQQTSSER + Deamidated (NQ) | |
| 738.3355 | 2949.3129 | 2949.2792 | 11.4 | 0 | 3 | 0.52 | 1Score > 20 indicates identityScore > 13 indicates homology |
AICDEMDIGIDIDLWMDEEPVPMNK + Deamidated (NQ) | |
| 535.7434 | 1069.4723 | 1069.4750 | -2.55 | 0 | 3 | 1.5 | 1Score > 18 indicates identity |
EYEMEVVR + Oxidation (M) | |
| 454.7066 | 1814.7972 | 1814.7678 | 16.2 | 0 | 3 | 1.5 | 1Score > 17 indicates identity |
VYMWVGMMPDSDPQK + 2 Oxidation (M) | |
| 495.2250 | 1976.8708 | 1976.8806 | -4.93 | 1 | 3 | 1 | 1Score > 20 indicates identityScore > 16 indicates homology |
KQWSWGHSEFGQAWDK + Deamidated (NQ) | |
| 724.8293 | 2895.2883 | 2895.3387 | -17.4 | 1 | 3 | 1.8 | 1Score > 18 indicates identity |
WCRTNAVDVVLMDMSMPGIGGLEATR + Deamidated (NQ); Oxidation (M) | |
| 832.8785 | 1663.7424 | 1663.7559 | -8.10 | 1 | 3 | 2.2 | 1Score > 19 indicates identity |
FSLCLAHCTDERR | |
| 873.3969 | 3489.5585 | 3489.5641 | -1.58 | 1 | 3 | 0.55 | 1Score > 22 indicates identityScore > 13 indicates homology |
NIAMVFQNYALYPHMTVYDNMAFGLKMQK + 4 Deamidated (NQ); 3 Oxidation (M) | |
| 684.3109 | 2733.2145 | 2733.2577 | -15.8 | 0 | 3 | 1 | 1Score > 20 indicates identityScore > 16 indicates homology |
NQGTAQNIQLELQDDSGNTLNTGATK + 3 Deamidated (NQ) | |
| 792.3600 | 1582.7055 | 1582.7045 | 0.64 | 1 | 3 | 0.99 | 1Score > 21 indicates identityScore > 16 indicates homology |
CQYETLVENNRR + 2 Deamidated (NQ) | |
| 980.1954 | 2937.5645 | 2937.5117 | 18.0 | 0 | 3 | 1.8 | 1Score > 18 indicates identity |
AATIAHVQQNAAVLEVELSSAELAMLDK + Oxidation (M) | |
| 535.7434 | 2138.9445 | 2138.9716 | -12.7 | 1 | 3 | 1.5 | 1Score > 18 indicates identity |
ITGSQVKNNGYVQDTNNQR + 4 Deamidated (NQ) | |
| 670.8048 | 1339.5951 | 1339.6190 | -17.9 | 1 | 3 | 2.2 | 1Score > 19 indicates identity |
KDSGFQMNQLR + Deamidated (NQ); Oxidation (M) | |
| 576.2618 | 2301.0183 | 2300.9751 | 18.7 | 0 | 3 | 1 | 1Score > 20 indicates identityScore > 16 indicates homology |
MSAIENFDAHTPMMQQYLR + 3 Deamidated (NQ); Oxidation (M) | |
| 603.2741 | 1806.8005 | 1806.7989 | 0.91 | 0 | 3 | 1 | 1Score > 20 indicates identityScore > 16 indicates homology |
QQMLPNTNGGMLNSNR + Deamidated (NQ); 2 Oxidation (M) | |
| 427.6943 | 853.3741 | 853.3600 | 16.5 | 0 | 3 | 1 | 1Score > 16 indicates identity |
MTSSAGQR + Deamidated (NQ); Oxidation (M) | |
| 535.7434 | 2138.9445 | 2138.9765 | -14.9 | 0 | 3 | 1.5 | 1Score > 18 indicates identity |
EIFTAMGIDFHLNCEIGR + Deamidated (NQ); Oxidation (M) | |
| 886.9030 | 1771.7915 | 1771.8233 | -18.0 | 1 | 3 | 2.2 | 1Score > 19 indicates identity |
MGDTAEQMAKTYGITR | |
| 495.2250 | 1482.6531 | 1482.6443 | 5.96 | 1 | 3 | 1 | 1Score > 20 indicates identityScore > 16 indicates homology |
MSGDNGMTEEKLR + Oxidation (M) | |
| 684.3109 | 1366.6073 | 1366.6187 | -8.36 | 0 | 3 | 0.77 | 1Score > 20 indicates identityScore > 15 indicates homology |
EQTAWLSGTMAR + Deamidated (NQ); Oxidation (M) | |
| 738.3355 | 2949.3129 | 2949.2792 | 11.4 | 0 | 3 | 0.5 | 1Score > 20 indicates identityScore > 13 indicates homology |
AICDEMDIGIDIDLWMDEEPVPMNK + Deamidated (NQ) | |
| 765.3478 | 2293.0215 | 2293.0467 | -11.0 | 1 | 3 | 0.8 | 1Score > 21 indicates identityScore > 15 indicates homology |
RYYNTAGSMMTEAAIDGGITR + Oxidation (M) | |
| 900.4092 | 1798.8038 | 1798.7971 | 3.74 | 0 | 3 | 1 | 1Score > 20 indicates identityScore > 16 indicates homology |
VIYSTYESNETMYAK + Deamidated (NQ) | |
| 980.1954 | 3916.7526 | 3916.7167 | 9.17 | 1 | 3 | 1.8 | 1Score > 18 indicates identity |
DGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNK + 7 Deamidated (NQ); Oxidation (M) | |
| 522.2372 | 1042.4599 | 1042.4576 | 2.26 | 0 | 3 | 2.3 | 1Score > 19 indicates identity |
GFADAIMMR + 2 Oxidation (M) | |
| 657.2986 | 2625.1655 | 2625.1720 | -2.49 | 1 | 3 | 0.54 | 1Score > 21 indicates identityScore > 13 indicates homology |
VMQVSAMADQMLLDSKNPQSAGNR + 3 Deamidated (NQ); 2 Oxidation (M) | |
| 751.8416 | 3003.3374 | 3003.3832 | -15.3 | 0 | 3 | 2.1 | 1Score > 19 indicates identity |
AQNSNLNSDQLVTLQVSNSGDQPLWLR + 7 Deamidated (NQ) | |
| 522.2372 | 2084.9199 | 2084.9296 | -4.66 | 0 | 3 | 2.3 | 1Score > 19 indicates identity |
EHVATGIDCYMQQFGVSK + Oxidation (M) | |
| 387.1759 | 1544.6744 | 1544.7003 | -16.8 | 0 | 3 | 1.2 | 1Score > 16 indicates identity |
LYPFEMSGGMLQR + Deamidated (NQ); Oxidation (M) | |
| 414.1881 | 1652.7235 | 1652.7385 | -9.12 | 0 | 3 | 2.3 | 1Score > 19 indicates identity |
AMMDNLQTETVINR + 2 Deamidated (NQ); Oxidation (M) | |
| 927.4214 | 2779.2425 | 2779.2577 | -5.46 | 1 | 3 | 1 | 1Score > 21 indicates identityScore > 16 indicates homology |
FSQTMMWIDTVNGLIMVDCASAKK + 2 Deamidated (NQ); 2 Oxidation (M) | |
| 954.4337 | 1906.8529 | 1906.8796 | -14.0 | 0 | 3 | 1 | 1Score > 21 indicates identityScore > 16 indicates homology |
QDIADYVASNIQDPLSR + 3 Deamidated (NQ) | |
| 427.6943 | 1706.7481 | 1706.7756 | -16.1 | 1 | 3 | 1 | 1Score > 16 indicates identity |
EEVVGAEMMRHFEK + Oxidation (M) | |
| 454.7066 | 1814.7972 | 1814.8100 | -7.07 | 0 | 3 | 1.5 | 1Score > 17 indicates identity |
VMQVSAMADQMLLDSK + Deamidated (NQ); 3 Oxidation (M) | |
| 657.2986 | 1968.8741 | 1968.8849 | -5.48 | 0 | 3 | 1 | 1Score > 21 indicates identityScore > 16 indicates homology |
GVEAVMYMGTLSYEQFK + Deamidated (NQ); Oxidation (M) | |
| 819.3723 | 2455.0951 | 2455.1399 | -18.3 | 0 | 3 | 0.58 | 1Score > 21 indicates identityScore > 13 indicates homology |
IPTWIMQGYATLADEAVEQMR + Deamidated (NQ); 2 Oxidation (M) | |
| 980.1954 | 3916.7526 | 3916.7167 | 9.17 | 1 | 3 | 1.8 | 1Score > 18 indicates identity |
DGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNK + 7 Deamidated (NQ); Oxidation (M) | |
| 454.7066 | 907.3986 | 907.4069 | -9.16 | 0 | 3 | 1.5 | 1Score > 17 indicates identity |
AALDNMTR + Deamidated (NQ); Oxidation (M) | |
| 468.2127 | 1401.6163 | 1401.6419 | -18.3 | 1 | 3 | 1 | 1Score > 20 indicates identityScore > 16 indicates homology |
MQTNPQNQQRR + 2 Deamidated (NQ) | |
| 468.2127 | 934.4109 | 934.4066 | 4.58 | 0 | 3 | 1 | 1Score > 20 indicates identityScore > 16 indicates homology |
MTPQESDK | |
| 549.2496 | 1096.4846 | 1096.4893 | -4.25 | 0 | 3 | 1 | 1Score > 20 indicates identityScore > 16 indicates homology |
DEMIMSAIR + 2 Oxidation (M) | |
| 562.7557 | 1123.4968 | 1123.5179 | -18.8 | 0 | 3 | 1.8 | 1Score > 18 indicates identity |
SASLSDIEMR + Oxidation (M) | |
| 697.8171 | 2787.2392 | 2787.2408 | -0.57 | 0 | 3 | 2.3 | 1Score > 19 indicates identity |
GFMVLGFPCNQFLEQEPGSDEEIK + Deamidated (NQ); Oxidation (M) | |
| 522.2372 | 1563.6899 | 1563.7126 | -14.5 | 0 | 3 | 2.4 | 1Score > 19 indicates identity |
NAMLPLENSDSPFK + 2 Deamidated (NQ) | |
| 562.7557 | 1123.4968 | 1123.5033 | -5.78 | 1 | 3 | 1.8 | 1Score > 18 indicates identity |
DKNFDNIQK + 3 Deamidated (NQ) | |
| 562.7557 | 2246.9936 | 2247.0253 | -14.1 | 1 | 3 | 1.8 | 1Score > 18 indicates identity |
VKMDVYDLFVNSDLDSADGK + Deamidated (NQ); Oxidation (M) | |
| 414.1881 | 1652.7235 | 1652.7529 | -17.8 | 0 | 3 | 2.3 | 1Score > 19 indicates identity |
EQDNIAIVTYAGDSR + 2 Deamidated (NQ) | |
| 819.3723 | 1636.7301 | 1636.7185 | 7.07 | 0 | 3 | 0.56 | 1Score > 21 indicates identityScore > 13 indicates homology |
VGGLSVMCEDAEAAGR + Oxidation (M) | |
| 495.2250 | 1482.6531 | 1482.6806 | -18.6 | 0 | 3 | 1 | 1Score > 20 indicates identityScore > 16 indicates homology |
MVNSGTEATMSAIR + Oxidation (M) | |
| 792.3600 | 2374.0583 | 2374.0423 | 6.75 | 0 | 3 | 1 | 1Score > 21 indicates identityScore > 16 indicates homology |
IEYVGNGYINEAQNMGWLQR + 4 Deamidated (NQ); Oxidation (M) | |
| 387.1759 | 1544.6744 | 1544.6889 | -9.41 | 0 | 3 | 1.2 | 1Score > 16 indicates identity |
QAGCTLHEVGTTNR + 2 Deamidated (NQ) | |
| 549.2496 | 1096.4846 | 1096.4794 | 4.76 | 0 | 3 | 0.74 | 1Score > 20 indicates identityScore > 14 indicates homology |
CCISAAPYR | |
| 562.7557 | 1123.4968 | 1123.5179 | -18.8 | 0 | 3 | 1.8 | 1Score > 18 indicates identity |
SASLSDIEMR + Oxidation (M) | |
| 873.3969 | 1744.7793 | 1744.8097 | -17.4 | 1 | 3 | 1 | 1Score > 22 indicates identityScore > 16 indicates homology |
MSHIQRETSCSRPR + Deamidated (NQ) | |
| 927.4214 | 2779.2425 | 2779.2541 | -4.17 | 1 | 3 | 1 | 1Score > 21 indicates identityScore > 16 indicates homology |
DLMQQARHEQPPVNVSELETMHR + 3 Deamidated (NQ); 2 Oxidation (M) | |
| 603.2741 | 1806.8005 | 1806.8054 | -2.70 | 1 | 3 | 1 | 1Score > 20 indicates identityScore > 16 indicates homology |
VSNQQDDMTKNAQAEK + Deamidated (NQ) | |
| 495.2250 | 1482.6531 | 1482.6474 | 3.81 | 0 | 3 | 1 | 1Score > 20 indicates identityScore > 16 indicates homology |
DLETQSQDGTFDK | |
| 765.3478 | 3057.3620 | 3057.3702 | -2.67 | 1 | 3 | 1 | 1Score > 21 indicates identityScore > 16 indicates homology |
VTPDMEFAQQFFADLHNNFQKAAAANK + 5 Deamidated (NQ) | |
| 873.3969 | 3489.5585 | 3489.5181 | 11.6 | 1 | 3 | 0.97 | 1Score > 22 indicates identityScore > 15 indicates homology |
SDVVNYVSENLKDYLQTMGYSGNDEEFIEK + 4 Deamidated (NQ) | |
| 913.9153 | 1825.8160 | 1825.8087 | 4.01 | 1 | 3 | 2.2 | 1Score > 19 indicates identity |
NGMECGIGVKNYNDVR + Deamidated (NQ) | |
| 454.7066 | 907.3986 | 907.3817 | 18.6 | 1 | 3 | 1.6 | 1Score > 17 indicates identity |
ENMGRER + Deamidated (NQ); Oxidation (M) | |
| 657.2986 | 2625.1655 | 2625.1397 | 9.83 | 1 | 3 | 0.98 | 1Score > 21 indicates identityScore > 16 indicates homology |
VDQEYEGIVRQLMTYMMEDSR + Deamidated (NQ); 2 Oxidation (M) | |
| 873.3969 | 3489.5585 | 3489.6244 | -18.9 | 1 | 3 | 1 | 1Score > 22 indicates identityScore > 16 indicates homology |
AQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQK + 2 Deamidated (NQ) | |
| 400.6820 | 1598.6989 | 1598.6990 | -0.051 | 0 | 3 | 1.1 | 1Score > 16 indicates identity |
SDVTPALSEMMQMK + 2 Oxidation (M) | |
| 414.1881 | 1239.5426 | 1239.5376 | 4.01 | 0 | 3 | 2.3 | 1Score > 19 indicates identity |
SVMDNMWLGR + 2 Oxidation (M) | |
| 562.7557 | 1123.4968 | 1123.4824 | 12.8 | 1 | 3 | 1.9 | 1Score > 18 indicates identity |
RQMMGMEPK + Deamidated (NQ); Oxidation (M) | |
| 603.2741 | 1204.5337 | 1204.5546 | -17.4 | 0 | 3 | 0.54 | 1Score > 20 indicates identityScore > 13 indicates homology |
HMDYGVQINK + Deamidated (NQ) | |
| 616.7802 | 2463.0917 | 2463.0987 | -2.84 | 1 | 3 | 1.8 | 1Score > 18 indicates identity |
GKVMLFGHWDNECEIPDPYR + Deamidated (NQ) | |
| 819.3723 | 2455.0951 | 2455.0815 | 5.54 | 1 | 3 | 1 | 1Score > 21 indicates identityScore > 16 indicates homology |
QSAFSEEWDEWETLLDANKR + 2 Deamidated (NQ) | |
| 427.6943 | 853.3741 | 853.3600 | 16.5 | 0 | 3 | 1.1 | 1Score > 16 indicates identity |
MTSSAGQR + Deamidated (NQ); Oxidation (M) | |
| 630.2864 | 1887.8373 | 1887.8461 | -4.68 | 0 | 3 | 0.89 | 1Score > 20 indicates identityScore > 15 indicates homology |
AQAAQPDQLMSDYFFR + Deamidated (NQ) | |
| 873.3969 | 2617.1689 | 2617.2040 | -13.4 | 0 | 3 | 0.58 | 1Score > 22 indicates identityScore > 13 indicates homology |
VECLELDNLMETAYATAVSANFR + Deamidated (NQ) | |
| 940.9276 | 3759.6811 | 3759.6935 | -3.30 | 0 | 3 | 2.3 | 1Score > 19 indicates identity |
LMIALEMIGYYDSAPGSQNYPYPAMSWLYPDR + 3 Oxidation (M) | |
| 495.2250 | 1976.8708 | 1976.8356 | 17.8 | 0 | 3 | 1 | 1Score > 20 indicates identityScore > 16 indicates homology |
GWGMQSHDSSVMQLQQR + 3 Deamidated (NQ) | |
| 630.2864 | 1258.5582 | 1258.5724 | -11.3 | 1 | 3 | 1 | 1Score > 20 indicates identityScore > 16 indicates homology |
TAMGEPGPDGRR + Oxidation (M) | |
| 819.3723 | 2455.0951 | 2455.1399 | -18.3 | 0 | 3 | 1 | 1Score > 21 indicates identityScore > 16 indicates homology |
IPTWIMQGYATLADEAVEQMR + Deamidated (NQ); 2 Oxidation (M) | |
| 832.8785 | 1663.7424 | 1663.7359 | 3.91 | 0 | 3 | 2.3 | 1Score > 19 indicates identity |
AMEDQIINDLNDTR + Deamidated (NQ); Oxidation (M) | |
| 886.9030 | 3543.5830 | 3543.6287 | -12.9 | 1 | 3 | 2.3 | 1Score > 19 indicates identity |
QQEMNTQTGRFAADMQVSLVNDGPVTFWLQV + 2 Deamidated (NQ); 2 Oxidation (M) | |
| 522.2372 | 2084.9199 | 2084.9322 | -5.92 | 0 | 3 | 2.4 | 1Score > 19 indicates identity |
VQIEPLYNQEQFDVVMM + 3 Deamidated (NQ) |
Not what you expected? Try
the select summary.