MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 4 Dec 2025 at 15:28:39 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 601–700 (out of 7566)


Page: Previous 1 2 3 4 5 6 7 8 9 10 11 12  76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
259 400.6820 1598.6989 1598.6990 -0.051 0 4 0.92 +1Score > 16 indicates identity SDVTPALSEMMQMK + 2 Oxidation (M)
3361 643.7925 2571.1411 2571.0967 17.3 0 4 1.6 +1Score > 18 indicates identity CLYCYSSAGFAAENELSLEEMK
4123 711.3232 1420.6319 1420.6252 4.72 0 4 1 +1Score > 21 indicates identity
Score > 16 indicates homology
ECNNQATQQSLK + Deamidated (NQ)
1317 481.7188 961.4231 961.4215 1.67 0 4 1.4 +1Score > 18 indicates identity GSMTFFEK + Oxidation (M)
3700 670.8048 1339.5951 1339.6190 -17.9 1 4 1.9 +1Score > 19 indicates identity KDSGFQMNQLR + Deamidated (NQ); Oxidation (M)
7510 980.1954 2937.5645 2937.5845 -6.81 0 4 1.5 +1Score > 18 indicates identity GNLVAVISNGTAVLGLGNIGALAGKPVMEGK + 2 Deamidated (NQ); Oxidation (M)
3080 630.2864 2517.1164 2517.1550 -15.3 0 4 0.94 +1Score > 20 indicates identity
Score > 16 indicates homology
QCGFSTLTSVPGVMVLMENSATR + Deamidated (NQ); 2 Oxidation (M)
462 414.1881 826.3617 826.3643 -3.13 0 4 1.9 +1Score > 19 indicates identity MYVNQR + Deamidated (NQ); Oxidation (M)
4922 778.8539 1555.6932 1555.7201 -17.3 1 4 1.6 +1Score > 18 indicates identity TTNNPRNSMFAFR + Deamidated (NQ)
7535 980.1954 2937.5645 2937.5117 18.0 0 4 1.5 +1Score > 18 indicates identity AATIAHVQQNAAVLEVELSSAELAMLDK + Oxidation (M)
7538 980.1954 2937.5645 2937.5308 11.5 1 4 1.5 +1Score > 18 indicates identity QTFQADLAIVGAGGAGLRAAIAAAQANPNAK + 2 Deamidated (NQ)
1823 522.2372 2084.9199 2084.9355 -7.47 1 4 2 +1Score > 19 indicates identity MTSVGSQDTTGPMTRDELK + 2 Oxidation (M)
6127 873.3969 1744.7793 1744.8002 -12.0 0 4 0.47 +1Score > 22 indicates identity
Score > 13 indicates homology
IADALINEAQQDLQSN + 3 Deamidated (NQ)
7181 954.4337 1906.8529 1906.8392 7.18 0 4 1 +1Score > 21 indicates identity
Score > 16 indicates homology
SNDSTATATQEVQQPNSK + 2 Deamidated (NQ)
7516 980.1954 3916.7526 3916.8288 -19.4 1 4 1.6 +1Score > 18 indicates identity QLLCQGMVLADAFYYVGENGERNWVSPVDAIVER + 3 Deamidated (NQ); Oxidation (M)
3028 616.7802 1231.5459 1231.5680 -18.0 0 4 1.5 +1Score > 18 indicates identity TDAEQAQELAR + Deamidated (NQ)
4831 765.3478 3057.3620 3057.4162 -17.7 1 4 1 +1Score > 21 indicates identity
Score > 16 indicates homology
LEPQAEDAPLNNYANERLTQLNQQQR + 5 Deamidated (NQ)
83 387.1759 1544.6744 1544.7048 -19.7 1 4 1 +1Score > 16 indicates identity KDAWYFANYDPR
753 441.2004 880.3863 880.3862 0.20 0 4 0.91 +1Score > 20 indicates identity
Score > 16 indicates homology
GFCAGVDR
1019 454.7066 1814.7972 1814.8100 -7.07 0 4 1.3 +1Score > 17 indicates identity VMQVSAMADQMLLDSK + Deamidated (NQ); 3 Oxidation (M)
7197 954.4337 3813.7058 3813.6842 5.66 1 4 0.51 +1Score > 21 indicates identity
Score > 13 indicates homology
IMTGAPVPEGCEAVVMQEQTEQMDNGVRFTAEVR + 3 Deamidated (NQ); 2 Oxidation (M)
580 427.6943 853.3741 853.3600 16.5 0 4 0.9 +1Score > 16 indicates identity MTSSAGQR + Deamidated (NQ); Oxidation (M)
2568 589.7679 2355.0427 2355.0206 9.38 1 4 1.8 +1Score > 19 indicates identity AMMDNLQTETVINRDGQEEK + 2 Deamidated (NQ); 2 Oxidation (M)
6604 900.4092 3597.6076 3597.6697 -17.3 1 4 1 +1Score > 20 indicates identity
Score > 16 indicates homology
VKSWWVNAGEAFMIYSLAENFCSSNGYTLPR + Deamidated (NQ)
243 400.6820 1598.6989 1598.7186 -12.3 1 4 0.94 +1Score > 16 indicates identity GGQHSGGNFKNDPQR + Deamidated (NQ)
578 427.6943 853.3741 853.3851 -13.0 0 4 0.9 +1Score > 16 indicates identity GEMSTVSK + Oxidation (M)
2134 549.2496 1644.7269 1644.7267 0.13 0 4 1 +1Score > 20 indicates identity
Score > 16 indicates homology
WQQELNSPNEQIR + 4 Deamidated (NQ)
2948 616.7802 1231.5459 1231.5680 -18.0 0 4 1.5 +1Score > 18 indicates identity TDAEQAQELAR + Deamidated (NQ)
967 454.7066 907.3986 907.3957 3.23 0 4 1.3 +1Score > 17 indicates identity ELMEGNAK + Deamidated (NQ); Oxidation (M)
1806 522.2372 2084.9199 2084.9287 -4.22 0 4 2 +1Score > 19 indicates identity QTSLNGFYQDNGGDADLLR + 2 Deamidated (NQ)
464 414.1881 1239.5426 1239.5554 -10.3 0 4 2 +1Score > 19 indicates identity DQYAGAVETMR
1158 468.2127 1401.6163 1401.6259 -6.88 0 4 1 +1Score > 20 indicates identity
Score > 16 indicates homology
QQEATQPDDVIR + 3 Deamidated (NQ)
2096 549.2496 1096.4846 1096.4753 8.44 1 4 0.84 +1Score > 20 indicates identity
Score > 15 indicates homology
GDARMMASSR + Oxidation (M)
3079 630.2864 1887.8373 1887.8461 -4.68 0 4 1 +1Score > 20 indicates identity
Score > 16 indicates homology
AQAAQPDQLMSDYFFR + Deamidated (NQ)
6483 900.4092 3597.6076 3597.5592 13.5 0 4 0.45 +1Score > 20 indicates identity
Score > 13 indicates homology
DVEAVLSSDSYPFFLDAMYGDMPNNWSPELR + Deamidated (NQ); 2 Oxidation (M)
1729 522.2372 1042.4599 1042.4576 2.26 0 4 2.1 +1Score > 19 indicates identity GFADAIMMR + 2 Oxidation (M)
631 427.6943 853.3741 853.3674 7.85 0 4 0.91 +1Score > 16 indicates identity VMNMQAK + Deamidated (NQ); 2 Oxidation (M)
2603 589.7679 1177.5213 1177.5338 -10.6 0 4 1.8 +1Score > 19 indicates identity MEYQHWLR + Oxidation (M)
4259 724.8293 2895.2883 2895.3385 -17.3 0 4 1.6 +1Score > 18 indicates identity QAYGQALAMYHGQTYQIAPEQPLGDK + 2 Deamidated (NQ); Oxidation (M)
6827 927.4214 3705.6567 3705.6848 -7.59 0 4 0.78 +1Score > 21 indicates identity
Score > 15 indicates homology
MGNAQLVDSMVADGLTDAYNQYQMGITAENIVEK + Deamidated (NQ); Oxidation (M)
2521 576.2618 1150.5091 1150.5288 -17.1 0 4 1 +1Score > 20 indicates identity
Score > 16 indicates homology
QTQLTEEMR + Oxidation (M)
6919 927.4214 1852.8283 1852.8248 1.92 0 4 1 +1Score > 21 indicates identity
Score > 16 indicates homology
LMDDTIAQVQTSGEAEK + 2 Deamidated (NQ); Oxidation (M)
3435 657.2986 2625.1655 2625.1846 -7.27 1 4 0.67 +1Score > 21 indicates identity
Score > 14 indicates homology
YGQYPKAQAAQPDQLMSDYFFR + 2 Deamidated (NQ)
5463 819.3723 3273.4602 3273.4363 7.30 0 4 0.72 +1Score > 21 indicates identity
Score > 15 indicates homology
YNGLPSMEIQGEAAPGTSSGDAMALMENLASK + 2 Deamidated (NQ); 2 Oxidation (M)
6659 913.9153 3651.6320 3651.7034 -19.5 1 4 1.9 +1Score > 19 indicates identity RLNEMEIYPGVTFSEELEGQLFASIMLDMEK + Deamidated (NQ); 2 Oxidation (M)
1083 468.2127 934.4109 934.4145 -3.85 0 4 0.98 +1Score > 20 indicates identity
Score > 16 indicates homology
TDGTWEAR
1626 508.7311 1015.4477 1015.4570 -9.15 0 4 1.2 +1Score > 17 indicates identity TINNAPDNR + 2 Deamidated (NQ)
622 427.6943 853.3741 853.3674 7.85 0 4 0.92 +1Score > 16 indicates identity VMNMQAK + Deamidated (NQ); 2 Oxidation (M)
5472 819.3723 1636.7301 1636.7185 7.07 0 4 0.86 +1Score > 21 indicates identity
Score > 16 indicates homology
VGGLSVMCEDAEAAGR + Oxidation (M)
1502 495.2250 1482.6531 1482.6660 -8.73 0 4 1 +1Score > 20 indicates identity
Score > 16 indicates homology
MYGDDLLGDEIAR + Oxidation (M)
2696 589.7679 2355.0427 2355.0796 -15.7 1 4 1.9 +1Score > 19 indicates identity NFVLMQQKMAAGENPAAEMIK + 3 Deamidated (NQ); 2 Oxidation (M)
5337 805.8662 3219.4357 3219.4487 -4.02 0 4 1.7 +1Score > 19 indicates identity NSFHVLDSQNNGVNANGTANGMSISLEAGQR + 2 Deamidated (NQ); Oxidation (M)
5813 846.3846 3381.5092 3381.5055 1.09 1 4 0.73 +1Score > 20 indicates identity
Score > 15 indicates homology
EAGVQEADFLANVDKLSEDAFDDQCTGANPR
381 414.1881 1239.5426 1239.5554 -10.3 0 4 2 +1Score > 19 indicates identity DQYAGAVETMR
390 414.1881 1652.7235 1652.7278 -2.62 1 4 2 +1Score > 19 indicates identity RFNTANDDNVTQVR + 4 Deamidated (NQ)
2241 562.7557 1123.4968 1123.5179 -18.8 0 4 1.6 +1Score > 18 indicates identity SASLSDIEMR + Oxidation (M)
364 414.1881 1652.7235 1652.7069 10.0 1 4 2 +1Score > 19 indicates identity RMGELMAESHASMR + 3 Oxidation (M)
1606 508.7311 2030.8955 2030.9044 -4.38 0 4 1.2 +1Score > 17 indicates identity DNGFFPNFSIAQNMAISR + 3 Deamidated (NQ)
2020 535.7434 1069.4723 1069.4862 -13.1 0 4 1.4 +1Score > 18 indicates identity YCVNSASLR + Deamidated (NQ)
3168 630.2864 1258.5582 1258.5789 -16.5 0 4 1 +1Score > 20 indicates identity
Score > 16 indicates homology
DDGLILNDNGGR + Deamidated (NQ)
5518 819.3723 2455.0951 2455.1393 -18.0 1 4 1 +1Score > 21 indicates identity
Score > 16 indicates homology
NISKNMQNTMGQVTTSAEQMLK + 2 Deamidated (NQ)
373 414.1881 826.3617 826.3677 -7.23 0 4 2 +1Score > 19 indicates identity MATVSMR + 2 Oxidation (M)
1728 522.2372 2084.9199 2084.9217 -0.86 0 4 2.1 +1Score > 19 indicates identity MNLDDIINSMMPEVYQR + Deamidated (NQ); Oxidation (M)
2822 603.2741 1204.5337 1204.5394 -4.76 0 4 1 +1Score > 20 indicates identity
Score > 16 indicates homology
DDPSMVADLSR
2902 616.7802 2463.0917 2463.1237 -13.0 1 4 1.6 +1Score > 18 indicates identity AWLYQGDHCLESRQSEAGVTR + Deamidated (NQ)
1848 522.2372 1042.4599 1042.4791 -18.4 1 4 2.1 +1Score > 19 indicates identity ANNPDRAER + Deamidated (NQ)
1818 522.2372 1563.6899 1563.7198 -19.1 1 4 2.1 +1Score > 19 indicates identity RQNLNIDSVSEMR + 3 Deamidated (NQ)
3123 630.2864 2517.1164 2517.1370 -8.17 0 4 1 +1Score > 20 indicates identity
Score > 16 indicates homology
NISQVSQSCGYNSTSYFISVFK + 2 Deamidated (NQ)
3482 657.2986 1312.5827 1312.5830 -0.17 0 4 1 +1Score > 21 indicates identity
Score > 16 indicates homology
NHCEILQGNAR + 2 Deamidated (NQ)
5280 805.8662 1609.7179 1609.7107 4.44 0 4 1.8 +1Score > 19 indicates identity TLNSNQFDNEDAIK + 2 Deamidated (NQ)
229 400.6820 1598.6989 1598.7113 -7.76 0 4 1 +1Score > 16 indicates identity EHEHEIAWYTER
4627 751.8416 1501.6687 1501.6772 -5.68 0 4 1.9 +1Score > 19 indicates identity YHQWMNELPER
808 441.2004 1760.7727 1760.7424 17.2 1 4 1 +1Score > 20 indicates identity
Score > 16 indicates homology
EDYAYSQQMQRDAR + Deamidated (NQ)
5467 819.3723 3273.4602 3273.4363 7.30 0 4 0.93 +1Score > 21 indicates identity
Score > 16 indicates homology
YNGLPSMEIQGEAAPGTSSGDAMALMENLASK + 2 Deamidated (NQ); 2 Oxidation (M)
367 414.1881 1652.7235 1652.7069 10.0 1 4 2.1 +1Score > 19 indicates identity RMGELMAESHASMR + 3 Oxidation (M)
3310 643.7925 2571.1411 2571.1655 -9.50 1 4 1.8 +1Score > 18 indicates identity MTANLQPGEYDMTCGLLTNPKGK + Deamidated (NQ); 2 Oxidation (M)
3991 697.8171 1393.6196 1393.6031 11.9 0 4 2.1 +1Score > 19 indicates identity TEQVNQQLMER + 3 Deamidated (NQ); Oxidation (M)
6882 927.4214 2779.2425 2779.2494 -2.49 0 4 1 +1Score > 21 indicates identity
Score > 16 indicates homology
VLGENGQEAVGSMGDDTPFAVLSSQPR + 3 Deamidated (NQ); Oxidation (M)
7368 967.9399 3867.7304 3867.7261 1.11 0 4 2.1 +1Score > 19 indicates identity EQPQYEENEAIPVYDTSGPYGDPQIAINVQQGLAK + 7 Deamidated (NQ)
340 400.6820 799.3495 799.3573 -9.77 0 3 1 +1Score > 16 indicates identity HAGNSGTR + Deamidated (NQ)
478 414.1881 1239.5426 1239.5587 -13.0 1 3 2.1 +1Score > 19 indicates identity TLKEMAQSCR + Deamidated (NQ); Oxidation (M)
4098 711.3232 1420.6319 1420.6504 -13.0 0 3 0.73 +1Score > 21 indicates identity
Score > 15 indicates homology
ENITNLDACITR + 2 Deamidated (NQ)
1904 535.7434 2138.9445 2138.9395 2.37 1 3 1.5 +1Score > 18 indicates identity GQASLDAGCDMILVCNNRK + 2 Deamidated (NQ); Oxidation (M)
2247 562.7557 2246.9936 2247.0075 -6.19 0 3 1.7 +1Score > 18 indicates identity SQMEIDFLELAMDEFIER + 2 Oxidation (M)
2748 603.2741 1806.8005 1806.7916 4.91 1 3 0.96 +1Score > 20 indicates identity
Score > 16 indicates homology
MQHETKMENQSWLK + 2 Deamidated (NQ); Oxidation (M)
812 441.2004 880.3863 880.3709 17.5 0 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
ATDSATCR
1769 522.2372 1042.4599 1042.4576 2.26 0 3 2.2 +1Score > 19 indicates identity GFADAIMMR + 2 Oxidation (M)
7156 954.4337 1906.8529 1906.8690 -8.46 1 3 0.91 +1Score > 21 indicates identity
Score > 16 indicates homology
LSAEDNARVNVAMNQTR + 3 Deamidated (NQ); Oxidation (M)
392 414.1881 1652.7235 1652.7253 -1.09 0 3 2.1 +1Score > 19 indicates identity CWQEEAYAEAQLR
2973 616.7802 2463.0917 2463.1051 -5.42 0 3 1.6 +1Score > 18 indicates identity VDGNLNSFELTGQAGADNHFNSR + Deamidated (NQ)
4438 738.3355 2211.9847 2211.9889 -1.88 1 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
EMASALSCPVGFKNGTDGNTR + Deamidated (NQ)
642 427.6943 853.3741 853.3600 16.5 0 3 0.97 +1Score > 16 indicates identity MTSSAGQR + Deamidated (NQ); Oxidation (M)
5971 859.8907 1717.7669 1717.8006 -19.6 1 3 1.7 +1Score > 18 indicates identity EKAQTQAEVEAQQQK + 3 Deamidated (NQ)
510 414.1881 826.3617 826.3565 6.38 0 3 2.1 +1Score > 19 indicates identity MLGQMSK + Deamidated (NQ); 2 Oxidation (M)
3615 670.8048 2679.1901 2679.2221 -11.9 0 3 2.1 +1Score > 19 indicates identity IENQEGLNNFDEILEASDGIMVAR + 3 Deamidated (NQ)
720 441.2004 880.3863 880.3862 0.20 0 3 0.89 +1Score > 20 indicates identity
Score > 15 indicates homology
GFCAGVDR
1138 468.2127 1868.8217 1868.8397 -9.60 0 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
AAVLCFAAESVATDCQR + Deamidated (NQ)
2710 589.7679 2355.0427 2355.0796 -15.7 1 3 2 +1Score > 19 indicates identity NFVLMQQKMAAGENPAAEMIK + 3 Deamidated (NQ); 2 Oxidation (M)
2905 616.7802 2463.0917 2463.1237 -13.0 1 3 1.7 +1Score > 18 indicates identity AWLYQGDHCLESRQSEAGVTR + Deamidated (NQ)
4156 711.3232 2841.2639 2841.3200 -19.8 1 3 0.54 +1Score > 21 indicates identity
Score > 13 indicates homology
LLGEQQTAQQLFSEMKQWAQEMAK + 3 Deamidated (NQ); Oxidation (M)
Page: Previous 1 2 3 4 5 6 7 8 9 10 11 12  76 Next 

Not what you expected? Try the select summary.