MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | test |
| MS data file | : | PRT1346_ENIGMA_14.mgf |
| Database | : | Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues) |
| Timestamp | : | 4 Dec 2025 at 15:28:39 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 7,621 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 5909 |
846.3846 | 3381.5092 | 3381.4772 | 9.47 | 1 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
NFKVPFNFYNVHYNSTHVVGTSGGSTDDMK + 4 Deamidated (NQ); Oxidation (M) |
| 2098 |
549.2496 | 1096.4846 | 1096.4753 | 8.44 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
GDARMMASSR + Oxidation (M) |
| 5786 |
846.3846 | 2536.1319 | 2536.1322 | -0.10 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
AASMITESQCYQLEQNLHQQR + 2 Deamidated (NQ) |
| 6554 |
900.4092 | 3597.6076 | 3597.5529 | 15.2 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
VGCMLAMVPLYPYSCNPDDVMFAQESMRER + 2 Oxidation (M) |
| 74 |
387.1759 | 1544.6744 | 1544.6889 | -9.41 | 0 | 4 | 0.87 | 1Score > 16 indicates identity |
QAGCTLHEVGTTNR + 2 Deamidated (NQ) |
| 1143 |
468.2127 | 1868.8217 | 1868.8496 | -14.9 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
MSKSIGNTVSPQDVMNK + 2 Deamidated (NQ); 2 Oxidation (M) |
| 6854 |
927.4214 | 1852.8283 | 1852.8295 | -0.61 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
QDIRAMQDQVMELSR + 2 Deamidated (NQ); 2 Oxidation (M) |
| 480 |
414.1881 | 826.3617 | 826.3564 | 6.40 | 1 | 4 | 1.7 | 1Score > 19 indicates identity |
MKMEEK + 2 Oxidation (M) |
| 629 |
427.6943 | 853.3741 | 853.3600 | 16.5 | 0 | 4 | 0.77 | 1Score > 16 indicates identity |
MTSSAGQR + Deamidated (NQ); Oxidation (M) |
| 6489 |
900.4092 | 2698.2057 | 2698.1884 | 6.41 | 1 | 4 | 0.56 | 1Score > 20 indicates identity Score > 14 indicates homology |
CVEADCGQMQEELDLTISAETRK + Oxidation (M) |
| 156 |
387.1759 | 1544.6744 | 1544.6889 | -9.41 | 0 | 4 | 0.88 | 1Score > 16 indicates identity |
QAGCTLHEVGTTNR + 2 Deamidated (NQ) |
| 6881 |
927.4214 | 1852.8283 | 1852.8625 | -18.4 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
LNNKEMNAQLDYLNR + 2 Deamidated (NQ); Oxidation (M) |
| 474 |
414.1881 | 826.3617 | 826.3531 | 10.5 | 0 | 4 | 1.7 | 1Score > 19 indicates identity |
MFQQQK + 2 Deamidated (NQ); Oxidation (M) |
| 3457 |
657.2986 | 1968.8741 | 1968.8591 | 7.62 | 0 | 4 | 0.75 | 1Score > 21 indicates identity Score > 16 indicates homology |
MPNVDVVGEMVNTMSASR + Deamidated (NQ); 2 Oxidation (M) |
| 5143 |
792.3600 | 2374.0583 | 2374.0899 | -13.3 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
LSANWMAAAGHPGEDAGLYEAVK + Deamidated (NQ); Oxidation (M) |
| 868 |
454.7066 | 1814.7972 | 1814.8100 | -7.07 | 0 | 4 | 1.1 | 1Score > 17 indicates identity |
VMQVSAMADQMLLDSK + Deamidated (NQ); 3 Oxidation (M) |
| 6040 |
859.8907 | 3435.5339 | 3435.5929 | -17.2 | 1 | 4 | 1.4 | 1Score > 18 indicates identity |
RQMLNEHYDVTTAAYAVGYESYPISVGNIR + 3 Deamidated (NQ); Oxidation (M) |
| 2178 |
549.2496 | 1096.4846 | 1096.4753 | 8.44 | 1 | 4 | 0.69 | 1Score > 20 indicates identity Score > 15 indicates homology |
GDARMMASSR + Oxidation (M) |
| 4449 |
738.3355 | 2211.9847 | 2212.0140 | -13.2 | 1 | 4 | 0.39 | 1Score > 20 indicates identity Score > 13 indicates homology |
MGRTQLQDAVPMTLGQEFR + 3 Deamidated (NQ); 2 Oxidation (M) |
| 4447 |
738.3355 | 1474.6565 | 1474.6657 | -6.24 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
ELHMGRMSQPTR + Deamidated (NQ); 2 Oxidation (M) |
| 1680 |
508.7311 | 2030.8955 | 2030.8646 | 15.2 | 0 | 4 | 1 | 1Score > 17 indicates identity |
EGYHQDWNTLIYNYGR + 3 Deamidated (NQ) |
| 4470 |
738.3355 | 1474.6565 | 1474.6834 | -18.3 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
RETQQMPEVGQR + Deamidated (NQ); Oxidation (M) |
| 5480 |
819.3723 | 3273.4602 | 3273.5169 | -17.3 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
MDAFIQYGIVAGVQAMQDSGLEITEENATR + Deamidated (NQ); Oxidation (M) |
| 990 |
454.7066 | 1814.7972 | 1814.7781 | 10.5 | 1 | 4 | 1.2 | 1Score > 17 indicates identity |
NMTFSKDDWQTQEGK + Deamidated (NQ) |
| 4783 |
765.3478 | 3057.3620 | 3057.4162 | -17.7 | 1 | 4 | 0.6 | 1Score > 21 indicates identity Score > 15 indicates homology |
LEPQAEDAPLNNYANERLTQLNQQQR + 5 Deamidated (NQ) |
| 1767 |
522.2372 | 2084.9199 | 2084.9296 | -4.66 | 0 | 4 | 1.8 | 1Score > 19 indicates identity |
EHVATGIDCYMQQFGVSK + Oxidation (M) |
| 2765 |
603.2741 | 1806.8005 | 1806.7818 | 10.4 | 1 | 4 | 0.7 | 1Score > 20 indicates identity Score > 15 indicates homology |
YRYAFINCTQCGPR + 2 Deamidated (NQ) |
| 3805 |
684.3109 | 1366.6073 | 1366.6221 | -10.8 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
LANAAITDMQMR + Deamidated (NQ); 2 Oxidation (M) |
| 85 |
387.1759 | 1158.5058 | 1158.5267 | -18.0 | 0 | 4 | 0.9 | 1Score > 16 indicates identity |
EAYELFMEK |
| 4534 |
738.3355 | 1474.6565 | 1474.6623 | -3.95 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
TNNMTLHTNWAR + Deamidated (NQ); Oxidation (M) |
| 250 |
400.6820 | 1598.6989 | 1598.7186 | -12.3 | 1 | 4 | 0.83 | 1Score > 16 indicates identity |
GGQHSGGNFKNDPQR + Deamidated (NQ) |
| 5366 |
805.8662 | 1609.7179 | 1609.7195 | -1.00 | 0 | 4 | 1.5 | 1Score > 19 indicates identity |
HCFSVVAQNQQYK + 2 Deamidated (NQ) |
| 5693 |
832.8785 | 3327.4848 | 3327.5071 | -6.69 | 1 | 4 | 1.7 | 1Score > 19 indicates identity |
NCATQFISCQDSVAALGMRVLGNPYGNDPR + Deamidated (NQ); Oxidation (M) |
| 5961 |
859.8907 | 3435.5339 | 3435.5818 | -14.0 | 0 | 4 | 1.4 | 1Score > 18 indicates identity |
DVNALMTAGQLINWGMPTLAAEMLNALDCQR + 3 Deamidated (NQ); Oxidation (M) |
| 1072 |
468.2127 | 1401.6163 | 1401.6194 | -2.24 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
TLPPGCEGEEASR |
| 48 |
387.1759 | 1158.5058 | 1158.5016 | 3.64 | 0 | 4 | 0.91 | 1Score > 16 indicates identity |
CVQQFDFSK + Deamidated (NQ) |
| 743 |
441.2004 | 1320.5795 | 1320.6054 | -19.6 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
SQLPGMVEDAMK + Oxidation (M) |
| 5785 |
846.3846 | 2536.1319 | 2536.1322 | -0.10 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
AASMITESQCYQLEQNLHQQR + 2 Deamidated (NQ) |
| 3467 |
657.2986 | 1968.8741 | 1968.8809 | -3.43 | 0 | 4 | 0.61 | 1Score > 21 indicates identity Score > 15 indicates homology |
YVLGDMLGQSPQMEQVR + 3 Deamidated (NQ); Oxidation (M) |
| 3827 |
684.3109 | 2049.9109 | 2049.9174 | -3.15 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
NAMQDLIDHAINHADNNK + Deamidated (NQ); Oxidation (M) |
| 2183 |
549.2496 | 1096.4846 | 1096.4753 | 8.44 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
GDARMMASSR + Oxidation (M) |
| 3254 |
643.7925 | 2571.1411 | 2571.1759 | -13.5 | 0 | 4 | 1.5 | 1Score > 18 indicates identity |
NNVTTDAGAGFEQTLTGMTVGIDSR + Deamidated (NQ); Oxidation (M) |
| 1551 |
508.7311 | 2030.8955 | 2030.9037 | -4.05 | 1 | 4 | 1 | 1Score > 17 indicates identity |
HGNSEMQKINQTSAMPEK + 2 Deamidated (NQ) |
| 3416 |
657.2986 | 1968.8741 | 1968.8809 | -3.43 | 1 | 4 | 0.79 | 1Score > 21 indicates identity Score > 16 indicates homology |
MVETSQCVPYPAKADEK + Deamidated (NQ); Oxidation (M) |
| 91 |
387.1759 | 1544.6744 | 1544.6889 | -9.41 | 0 | 4 | 0.93 | 1Score > 16 indicates identity |
QAGCTLHEVGTTNR + 2 Deamidated (NQ) |
| 2299 |
562.7557 | 1123.4968 | 1123.4968 | 0.031 | 1 | 4 | 1.4 | 1Score > 18 indicates identity |
MREYPNGEK + Deamidated (NQ) |
| 4106 |
711.3232 | 2130.9479 | 2130.9124 | 16.7 | 0 | 4 | 0.64 | 1Score > 21 indicates identity Score > 15 indicates homology |
NNTVYSAATQTGVCQGDTSR + 2 Deamidated (NQ) |
| 1795 |
522.2372 | 1563.6899 | 1563.6844 | 3.55 | 0 | 4 | 1.8 | 1Score > 19 indicates identity |
MICSPQNNTGAPMK + Oxidation (M) |
| 40 |
387.1759 | 772.3372 | 772.3351 | 2.67 | 0 | 4 | 0.93 | 1Score > 16 indicates identity |
AQGEDPR + Deamidated (NQ) |
| 167 |
387.1759 | 772.3372 | 772.3464 | -11.9 | 0 | 4 | 0.93 | 1Score > 16 indicates identity |
NNPDGTR |
| 3323 |
643.7925 | 1285.5705 | 1285.5946 | -18.7 | 1 | 4 | 1.5 | 1Score > 18 indicates identity |
SGRIDMGHGAGGR + Oxidation (M) |
| 783 |
441.2004 | 1760.7727 | 1760.8039 | -17.8 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
MPDAEFQSHIQLDSK + Oxidation (M) |
| 7158 |
954.4337 | 1906.8529 | 1906.8883 | -18.6 | 0 | 4 | 0.51 | 1Score > 21 indicates identity Score > 14 indicates homology |
WSSQMINTLQIQFHR + 3 Deamidated (NQ); Oxidation (M) |
| 456 |
414.1881 | 826.3617 | 826.3565 | 6.38 | 0 | 4 | 1.8 | 1Score > 19 indicates identity |
MLGQMSK + Deamidated (NQ); 2 Oxidation (M) |
| 2119 |
549.2496 | 1096.4846 | 1096.5005 | -14.5 | 1 | 4 | 0.61 | 1Score > 20 indicates identity Score > 15 indicates homology |
KLDMNSMAR + 2 Oxidation (M) |
| 836 |
441.2004 | 1320.5795 | 1320.6058 | -19.9 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
DNNRVGFAEAAR + 2 Deamidated (NQ) |
| 5450 |
819.3723 | 3273.4602 | 3273.4363 | 7.30 | 0 | 4 | 0.53 | 1Score > 21 indicates identity Score > 14 indicates homology |
YNGLPSMEIQGEAAPGTSSGDAMALMENLASK + 2 Deamidated (NQ); 2 Oxidation (M) |
| 931 |
454.7066 | 907.3986 | 907.3817 | 18.6 | 1 | 4 | 1.2 | 1Score > 17 indicates identity |
RDNQAMR + 2 Deamidated (NQ); Oxidation (M) |
| 3920 |
697.8171 | 1393.6196 | 1393.6031 | 11.9 | 0 | 4 | 1.8 | 1Score > 19 indicates identity |
TEQVNQQLMER + 3 Deamidated (NQ); Oxidation (M) |
| 1547 |
508.7311 | 1015.4477 | 1015.4611 | -13.1 | 0 | 4 | 1.1 | 1Score > 17 indicates identity |
YYDAETVR |
| 1961 |
535.7434 | 1069.4723 | 1069.4862 | -13.0 | 1 | 4 | 1.2 | 1Score > 18 indicates identity |
DAYREMAAK + Oxidation (M) |
| 5592 |
819.3723 | 2455.0951 | 2455.0696 | 10.4 | 0 | 4 | 0.49 | 1Score > 21 indicates identity Score > 14 indicates homology |
STPDFSTAENNQELANEVSCLK + 2 Deamidated (NQ) |
| 2035 |
535.7434 | 1069.4723 | 1069.4637 | 7.97 | 0 | 4 | 1.3 | 1Score > 18 indicates identity |
IEQFMQQK + 3 Deamidated (NQ); Oxidation (M) |
| 2102 |
549.2496 | 1096.4846 | 1096.4753 | 8.44 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
GDARMMASSR + Oxidation (M) |
| 3616 |
670.8048 | 2679.1901 | 2679.2421 | -19.4 | 1 | 4 | 1.8 | 1Score > 19 indicates identity |
RAVNPAVMMNDTLFNALNDWVDR + 2 Deamidated (NQ); Oxidation (M) |
| 4114 |
711.3232 | 2841.2639 | 2841.2491 | 5.19 | 0 | 4 | 0.55 | 1Score > 21 indicates identity Score > 14 indicates homology |
THEGNRPGDNWQFDGDAETIAHFAR + Deamidated (NQ) |
| 7370 |
967.9399 | 3867.7304 | 3867.7261 | 1.11 | 0 | 4 | 1.8 | 1Score > 19 indicates identity |
EQPQYEENEAIPVYDTSGPYGDPQIAINVQQGLAK + 7 Deamidated (NQ) |
| 721 |
441.2004 | 1760.7727 | 1760.7709 | 0.99 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
MMSEGLDPLAPADENR + Oxidation (M) |
| 4115 |
711.3232 | 1420.6319 | 1420.6293 | 1.87 | 0 | 4 | 0.74 | 1Score > 21 indicates identity Score > 15 indicates homology |
NLQTTGCESWPK + Deamidated (NQ) |
| 6124 |
873.3969 | 1744.7793 | 1744.8002 | -12.0 | 0 | 4 | 0.5 | 1Score > 22 indicates identity Score > 14 indicates homology |
IADALINEAQQDLQSN + 3 Deamidated (NQ) |
| 47 |
387.1759 | 1158.5058 | 1158.5267 | -18.0 | 0 | 4 | 0.96 | 1Score > 16 indicates identity |
EAYELFMEK |
| 1850 |
522.2372 | 1563.6899 | 1563.7205 | -19.6 | 0 | 4 | 1.9 | 1Score > 19 indicates identity |
AADAAFAEWGQTTPK + Deamidated (NQ) |
| 553 |
427.6943 | 853.3741 | 853.3851 | -13.0 | 0 | 4 | 0.85 | 1Score > 16 indicates identity |
GEMSTVSK + Oxidation (M) |
| 403 |
414.1881 | 1239.5426 | 1239.5661 | -19.0 | 0 | 4 | 1.9 | 1Score > 19 indicates identity |
SPMELMTMLR + 2 Oxidation (M) |
| 714 |
441.2004 | 880.3863 | 880.3709 | 17.5 | 0 | 4 | 0.58 | 1Score > 20 indicates identity Score > 14 indicates homology |
ATDSATCR |
| 1771 |
522.2372 | 1563.6899 | 1563.7205 | -19.6 | 0 | 4 | 1.9 | 1Score > 19 indicates identity |
FESTGSQLTFAGYR + Deamidated (NQ) |
| 7371 |
967.9399 | 3867.7304 | 3867.7261 | 1.11 | 0 | 4 | 1.9 | 1Score > 19 indicates identity |
EQPQYEENEAIPVYDTSGPYGDPQIAINVQQGLAK + 7 Deamidated (NQ) |
| 428 |
414.1881 | 826.3617 | 826.3643 | -3.13 | 0 | 4 | 1.9 | 1Score > 19 indicates identity |
MYVNQR + Deamidated (NQ); Oxidation (M) |
| 5270 |
805.8662 | 3219.4357 | 3219.4973 | -19.1 | 1 | 4 | 1.6 | 1Score > 19 indicates identity |
VAMMNRLQQALEHNHFFLMAQPITGMR + 4 Deamidated (NQ); 2 Oxidation (M) |
| 58 |
387.1759 | 772.3372 | 772.3351 | 2.67 | 0 | 4 | 0.97 | 1Score > 16 indicates identity |
AQGEDPR + Deamidated (NQ) |
| 2445 |
576.2618 | 1150.5091 | 1150.5077 | 1.26 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
DTANMQRWK + 2 Deamidated (NQ) |
| 3515 |
657.2986 | 1968.8741 | 1968.8734 | 0.34 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
DYSELNVAQGQEMIAQR + 2 Deamidated (NQ); Oxidation (M) |
| 3649 |
670.8048 | 2679.1901 | 2679.2349 | -16.7 | 0 | 4 | 1.9 | 1Score > 19 indicates identity |
TVYNQPANMFVSGFIGSPAMNFIR + 3 Deamidated (NQ); Oxidation (M) |
| 3979 |
697.8171 | 1393.6196 | 1393.6329 | -9.58 | 1 | 4 | 1.9 | 1Score > 19 indicates identity |
QAQQMQEKMQK + Deamidated (NQ); Oxidation (M) |
| 5803 |
846.3846 | 3381.5092 | 3381.5291 | -5.87 | 0 | 4 | 0.88 | 1Score > 20 indicates identity Score > 16 indicates homology |
DGCIAIACPITGDWVAMTNHTWAFSIAEMK + Oxidation (M) |
| 1854 |
522.2372 | 2084.9199 | 2084.9261 | -3.00 | 1 | 4 | 1.9 | 1Score > 19 indicates identity |
QYLNMQNGANFGPWRLR + 5 Deamidated (NQ); Oxidation (M) |
| 3922 |
697.8171 | 2787.2392 | 2787.2520 | -4.59 | 0 | 4 | 1.9 | 1Score > 19 indicates identity |
AGIPLDVMYDVVTNAAGNSWMFENR + 2 Deamidated (NQ); Oxidation (M) |
| 1483 |
495.2250 | 988.4354 | 988.4358 | -0.40 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
ISSGGMMFK + 2 Oxidation (M) |
| 7232 |
954.4337 | 2860.2793 | 2860.2466 | 11.4 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
YMGNNGPMQLEVPRDQYAGAVETMR + 2 Deamidated (NQ); 2 Oxidation (M) |
| 1398 |
495.2250 | 1482.6531 | 1482.6521 | 0.67 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
MNNNDLFQASRR + 2 Deamidated (NQ); Oxidation (M) |
| 1725 |
522.2372 | 2084.9199 | 2084.9287 | -4.22 | 0 | 4 | 2 | 1Score > 19 indicates identity |
QTSLNGFYQDNGGDADLLR + 2 Deamidated (NQ) |
| 6598 |
900.4092 | 3597.6076 | 3597.6697 | -17.3 | 1 | 4 | 0.65 | 1Score > 20 indicates identity Score > 15 indicates homology |
VKSWWVNAGEAFMIYSLAENFCSSNGYTLPR + Deamidated (NQ) |
| 1093 |
468.2127 | 1868.8217 | 1868.8363 | -7.78 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
MIEHSGGAESLANYFSR + Deamidated (NQ) |
| 1436 |
495.2250 | 1482.6531 | 1482.6806 | -18.6 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
MVNSGTEATMSAIR + Oxidation (M) |
| 3986 |
697.8171 | 1393.6196 | 1393.6473 | -19.9 | 1 | 4 | 1.9 | 1Score > 19 indicates identity |
NESAGEQLRFGGK + 2 Deamidated (NQ) |
| 3413 |
657.2986 | 1312.5827 | 1312.5643 | 14.0 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
HDVKGDNEENR + Deamidated (NQ) |
| 1086 |
468.2127 | 934.4109 | 934.4145 | -3.85 | 0 | 4 | 0.6 | 1Score > 20 indicates identity Score > 14 indicates homology |
TDGTWEAR |
| 3044 |
616.7802 | 2463.0917 | 2463.0570 | 14.1 | 1 | 4 | 1.5 | 1Score > 18 indicates identity |
LNKEMVEGMGGTQSEQYQEFR + 3 Deamidated (NQ) |
| 2419 |
576.2618 | 1725.7637 | 1725.7879 | -14.0 | 0 | 4 | 0.63 | 1Score > 20 indicates identity Score > 14 indicates homology |
AELGNNTEYDMLALR + Deamidated (NQ); Oxidation (M) |
| 6167 |
873.3969 | 3489.5585 | 3489.5468 | 3.36 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
GDGCGHCAACNLRANGLNHYLADKPTVMAAMK + Deamidated (NQ); Oxidation (M) |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/