MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | test |
| MS data file | : | PRT1346_ENIGMA_14.mgf |
| Database | : | Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues) |
| Timestamp | : | 4 Dec 2025 at 15:28:39 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 7,621 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 577 |
427.6943 | 853.3741 | 853.3600 | 16.5 | 0 | 5 | 0.66 | 1Score > 16 indicates identity |
MTSSAGQR + Deamidated (NQ); Oxidation (M) |
| 1851 |
522.2372 | 2084.9199 | 2084.9361 | -7.77 | 0 | 5 | 1.5 | 1Score > 19 indicates identity |
SDNCEDTPEAGYFAIAVVK |
| 3928 |
697.8171 | 2787.2392 | 2787.2612 | -7.90 | 0 | 5 | 1.5 | 1Score > 19 indicates identity |
QHHLWASQGSDFHQPCPWIELGR + 2 Deamidated (NQ) |
| 449 |
414.1881 | 1652.7235 | 1652.7278 | -2.62 | 0 | 5 | 1.5 | 1Score > 19 indicates identity |
AYSGEGAIADDAGNVSR + Deamidated (NQ) |
| 1577 |
508.7311 | 2030.8955 | 2030.9190 | -11.6 | 1 | 5 | 0.86 | 1Score > 17 indicates identity |
GRVYAVSMFNPQGNDMTK + Deamidated (NQ); Oxidation (M) |
| 633 |
427.6943 | 853.3741 | 853.3851 | -12.9 | 1 | 5 | 0.68 | 1Score > 16 indicates identity |
MSSKEQK + Deamidated (NQ); Oxidation (M) |
| 1563 |
508.7311 | 2030.8955 | 2030.8979 | -1.19 | 0 | 5 | 0.86 | 1Score > 17 indicates identity |
MSMGHEVVGHWFNEEVK + Oxidation (M) |
| 2874 |
603.2741 | 1204.5337 | 1204.5394 | -4.73 | 0 | 5 | 1 | 1Score > 20 indicates identity Score > 18 indicates homology |
ADCEQLAELR + Deamidated (NQ) |
| 3836 |
684.3109 | 1366.6073 | 1366.6266 | -14.1 | 1 | 5 | 0.52 | 1Score > 20 indicates identity Score > 15 indicates homology |
DWRETNIDYR |
| 5744 |
832.8785 | 3327.4848 | 3327.5452 | -18.2 | 1 | 5 | 1.5 | 1Score > 19 indicates identity |
IQTWQYSDSQQAISIEDNGCGIDLSLQKK + 3 Deamidated (NQ) |
| 488 |
414.1881 | 826.3617 | 826.3677 | -7.23 | 0 | 5 | 1.5 | 1Score > 19 indicates identity |
MATVSMR + 2 Oxidation (M) |
| 1387 |
495.2250 | 988.4354 | 988.4219 | 13.7 | 0 | 5 | 1 | 1Score > 20 indicates identity Score > 18 indicates homology |
GNHEVMMR + Oxidation (M) |
| 3445 |
657.2986 | 1312.5827 | 1312.5751 | 5.80 | 0 | 5 | 0.64 | 1Score > 21 indicates identity Score > 16 indicates homology |
NMVQNMLSSTR + Deamidated (NQ); 2 Oxidation (M) |
| 3471 |
657.2986 | 1968.8741 | 1968.8809 | -3.43 | 0 | 5 | 0.39 | 1Score > 21 indicates identity Score > 13 indicates homology |
YVLGDMLGQSPQMEQVR + 3 Deamidated (NQ); Oxidation (M) |
| 5493 |
819.3723 | 2455.0951 | 2455.1308 | -14.5 | 1 | 5 | 1 | 1Score > 21 indicates identity Score > 18 indicates homology |
QTPMRGHPVFIAQHATATCCR + Deamidated (NQ); Oxidation (M) |
| 975 |
454.7066 | 1814.7972 | 1814.7846 | 6.94 | 0 | 5 | 1 | 1Score > 17 indicates identity |
GFAAEGQSQNNYLNGLK + 5 Deamidated (NQ) |
| 2616 |
589.7679 | 2355.0427 | 2355.0518 | -3.86 | 1 | 5 | 1.4 | 1Score > 19 indicates identity |
NPVFWEKMNNGWDEFSIPK + 2 Deamidated (NQ); Oxidation (M) |
| 563 |
427.6943 | 1706.7481 | 1706.7610 | -7.56 | 0 | 5 | 0.68 | 1Score > 16 indicates identity |
WDTLEDVWNGLCAK + Deamidated (NQ) |
| 1051 |
468.2127 | 1868.8217 | 1868.8356 | -7.44 | 1 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
MSANTEAQGSGRGLEAMK + 2 Oxidation (M) |
| 4096 |
711.3232 | 2130.9479 | 2130.9124 | 16.7 | 0 | 5 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
NNTVYSAATQTGVCQGDTSR + 2 Deamidated (NQ) |
| 4703 |
751.8416 | 1501.6687 | 1501.6620 | 4.45 | 1 | 5 | 1.4 | 1Score > 19 indicates identity |
FDDRGDLSFMQR + Oxidation (M) |
| 795 |
441.2004 | 1320.5795 | 1320.5833 | -2.90 | 0 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
ILQYGNENPNR + 4 Deamidated (NQ) |
| 2906 |
616.7802 | 2463.0917 | 2463.0934 | -0.66 | 0 | 5 | 1.2 | 1Score > 18 indicates identity |
MAQITTTDANEFSSSAEFIPMR + Deamidated (NQ); Oxidation (M) |
| 3701 |
670.8048 | 1339.5951 | 1339.6190 | -17.9 | 1 | 5 | 1.5 | 1Score > 19 indicates identity |
KDSGFQMNQLR + Deamidated (NQ); Oxidation (M) |
| 5462 |
819.3723 | 1636.7301 | 1636.7303 | -0.17 | 1 | 5 | 0.63 | 1Score > 21 indicates identity Score > 15 indicates homology |
WQNMNENRTLWK + 2 Deamidated (NQ); Oxidation (M) |
| 819 |
441.2004 | 1320.5795 | 1320.6020 | -17.0 | 0 | 5 | 0.62 | 1Score > 20 indicates identity Score > 15 indicates homology |
DGIPLMEEDFR |
| 2172 |
549.2496 | 1096.4846 | 1096.4753 | 8.44 | 1 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
GDARMMASSR + Oxidation (M) |
| 96 |
387.1759 | 1158.5058 | 1158.5088 | -2.56 | 1 | 5 | 0.78 | 1Score > 16 indicates identity |
RMADEHGTDK |
| 408 |
414.1881 | 1652.7235 | 1652.7069 | 10.0 | 1 | 5 | 1.5 | 1Score > 19 indicates identity |
RMGELMAESHASMR + 3 Oxidation (M) |
| 1782 |
522.2372 | 1563.6899 | 1563.6771 | 8.17 | 0 | 5 | 1.6 | 1Score > 19 indicates identity |
MMFEFNMAELLR + Deamidated (NQ); 2 Oxidation (M) |
| 2230 |
562.7557 | 1123.4968 | 1123.4824 | 12.8 | 1 | 5 | 1.2 | 1Score > 18 indicates identity |
RQMMGMEPK + Deamidated (NQ); Oxidation (M) |
| 3472 |
657.2986 | 1968.8741 | 1968.8809 | -3.43 | 0 | 5 | 0.91 | 1Score > 21 indicates identity Score > 17 indicates homology |
YVLGDMLGQSPQMEQVR + 3 Deamidated (NQ); Oxidation (M) |
| 7151 |
954.4337 | 3813.7058 | 3813.7145 | -2.29 | 0 | 5 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
NGTTVQQWVSQAGAQDCVLALENESNPHNLGGMMR + 2 Deamidated (NQ) |
| 2830 |
603.2741 | 1204.5337 | 1204.5394 | -4.75 | 1 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
GDLKNMNPDGK + Deamidated (NQ); Oxidation (M) |
| 3226 |
630.2864 | 2517.1164 | 2517.1482 | -12.6 | 1 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
ENAGYVIYECYQPDDGDKLIR |
| 93 |
387.1759 | 1158.5058 | 1158.5267 | -18.0 | 0 | 5 | 0.79 | 1Score > 16 indicates identity |
FMAQYQELK + 2 Deamidated (NQ) |
| 3820 |
684.3109 | 2049.9109 | 2049.9479 | -18.0 | 1 | 5 | 0.41 | 1Score > 20 indicates identity Score > 14 indicates homology |
IEHYHDWLRDAHAMEK |
| 5475 |
819.3723 | 3273.4602 | 3273.5036 | -13.3 | 1 | 5 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
ACTQAAEVALFTYNSRAAQIWWQQNQSK + 4 Deamidated (NQ) |
| 6145 |
873.3969 | 2617.1689 | 2617.2118 | -16.4 | 1 | 5 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
GDLLELYCGNGNFSLALARNFDR + 3 Deamidated (NQ) |
| 505 |
414.1881 | 1652.7235 | 1652.7069 | 10.0 | 1 | 5 | 1.5 | 1Score > 19 indicates identity |
RMGELMAESHASMR + 3 Oxidation (M) |
| 6485 |
900.4092 | 1798.8038 | 1798.8151 | -6.27 | 0 | 5 | 0.83 | 1Score > 20 indicates identity Score > 17 indicates homology |
VMQVSAMADQMLLDSK + Deamidated (NQ); 2 Oxidation (M) |
| 6524 |
900.4092 | 3597.6076 | 3597.5545 | 14.8 | 0 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
GSMAMAAVCGTSGIASLFSQAAFAADSDIADGQTQR + 3 Deamidated (NQ); 2 Oxidation (M) |
| 3994 |
697.8171 | 2787.2392 | 2787.1972 | 15.1 | 1 | 5 | 1.6 | 1Score > 19 indicates identity |
MERGIDLTAMMAQGITMGDEFHQR + 2 Deamidated (NQ); 3 Oxidation (M) |
| 6764 |
913.9153 | 1825.8160 | 1825.8438 | -15.2 | 0 | 5 | 1.5 | 1Score > 19 indicates identity |
LDDMLEIQTEITSMR + 2 Oxidation (M) |
| 586 |
427.6943 | 1706.7481 | 1706.7280 | 11.8 | 0 | 5 | 0.7 | 1Score > 16 indicates identity |
FIEENHENIMACAK + 2 Deamidated (NQ) |
| 198 |
400.6820 | 799.3495 | 799.3422 | 9.09 | 0 | 5 | 0.74 | 1Score > 16 indicates identity |
FTQMQK + 2 Deamidated (NQ); Oxidation (M) |
| 470 |
414.1881 | 1239.5426 | 1239.5661 | -19.0 | 0 | 5 | 1.5 | 1Score > 19 indicates identity |
SPMELMTMLR + 2 Oxidation (M) |
| 4094 |
711.3232 | 2841.2639 | 2841.3003 | -12.8 | 1 | 5 | 0.7 | 1Score > 21 indicates identity Score > 16 indicates homology |
AKNGDNEYMAWDMTLGWIIWQQR + Oxidation (M) |
| 237 |
400.6820 | 799.3495 | 799.3460 | 4.28 | 0 | 5 | 0.74 | 1Score > 16 indicates identity |
ATDDHNK |
| 391 |
414.1881 | 1652.7235 | 1652.7253 | -1.09 | 0 | 5 | 1.5 | 1Score > 19 indicates identity |
CWQEEAYAEAQLR |
| 675 |
427.6943 | 1706.7481 | 1706.7437 | 2.58 | 0 | 5 | 0.71 | 1Score > 16 indicates identity |
QWVNNGFAGWNGQAR + 3 Deamidated (NQ) |
| 1516 |
495.2250 | 1482.6531 | 1482.6443 | 5.96 | 1 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
MSGDNGMTEEKLR + Oxidation (M) |
| 3249 |
643.7925 | 1285.5705 | 1285.5761 | -4.34 | 0 | 5 | 1.3 | 1Score > 18 indicates identity |
MQAYFDQLDR |
| 738 |
441.2004 | 880.3863 | 880.3960 | -11.0 | 0 | 5 | 0.81 | 1Score > 20 indicates identity Score > 16 indicates homology |
DSLMSANK + Oxidation (M) |
| 4443 |
738.3355 | 1474.6565 | 1474.6524 | 2.78 | 1 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
NMAWRHNPNYR + Deamidated (NQ); Oxidation (M) |
| 136 |
387.1759 | 772.3372 | 772.3464 | -11.9 | 0 | 5 | 0.81 | 1Score > 16 indicates identity |
NNPDGTR |
| 7425 |
967.9399 | 1933.8652 | 1933.8298 | 18.3 | 1 | 5 | 1.6 | 1Score > 19 indicates identity |
QSMGFDTNMEGGFLARR + 2 Deamidated (NQ); Oxidation (M) |
| 51 |
387.1759 | 1544.6744 | 1544.6594 | 9.70 | 0 | 5 | 0.82 | 1Score > 16 indicates identity |
MQEALMSLMQMAK + 2 Deamidated (NQ); 2 Oxidation (M) |
| 1134 |
468.2127 | 934.4109 | 934.4290 | -19.5 | 1 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
DCSLQRR + Deamidated (NQ) |
| 2436 |
576.2618 | 1725.7637 | 1725.7742 | -6.09 | 1 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
GMVNNKFNYFIMSK + 2 Deamidated (NQ); 2 Oxidation (M) |
| 1917 |
535.7434 | 2138.9445 | 2138.9716 | -12.7 | 1 | 5 | 1.1 | 1Score > 18 indicates identity |
ITGSQVKNNGYVQDTNNQR + 4 Deamidated (NQ) |
| 1919 |
535.7434 | 2138.9445 | 2138.9716 | -12.7 | 1 | 5 | 1.1 | 1Score > 18 indicates identity |
ITGSQVKNNGYVQDTNNQR + 4 Deamidated (NQ) |
| 639 |
427.6943 | 1706.7481 | 1706.7318 | 9.54 | 1 | 5 | 0.72 | 1Score > 16 indicates identity |
WDTLDDDRANGCIR + Deamidated (NQ) |
| 5476 |
819.3723 | 1636.7301 | 1636.7549 | -15.2 | 0 | 5 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
MQTQMQTQQIQQK + Deamidated (NQ); Oxidation (M) |
| 2101 |
549.2496 | 1096.4846 | 1096.4753 | 8.44 | 1 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
GDARMMASSR + Oxidation (M) |
| 6173 |
873.3969 | 1744.7793 | 1744.7904 | -6.37 | 0 | 5 | 0.39 | 1Score > 22 indicates identity Score > 13 indicates homology |
DIDVDYASHSPQIER + Deamidated (NQ) |
| 4439 |
738.3355 | 1474.6565 | 1474.6423 | 9.59 | 0 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
SETAQPSDQALAQQ + 2 Deamidated (NQ) |
| 4456 |
738.3355 | 2949.3129 | 2949.3499 | -12.5 | 0 | 5 | 0.38 | 1Score > 20 indicates identity Score > 13 indicates homology |
MNNAFMMHASTSPFYPLFAALNINAK + Deamidated (NQ); 3 Oxidation (M) |
| 1800 |
522.2372 | 1563.6899 | 1563.6771 | 8.17 | 0 | 5 | 1.6 | 1Score > 19 indicates identity |
MMFEFNMAELLR + Deamidated (NQ); 2 Oxidation (M) |
| 2079 |
549.2496 | 1096.4846 | 1096.5036 | -17.4 | 1 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
KYGPDSSTNK + Deamidated (NQ) |
| 4935 |
778.8539 | 1555.6932 | 1555.6759 | 11.1 | 0 | 5 | 1.3 | 1Score > 18 indicates identity |
QQVEGASAMGQMFR + Deamidated (NQ); Oxidation (M) |
| 26 |
387.1759 | 1544.6744 | 1544.6594 | 9.70 | 0 | 5 | 0.84 | 1Score > 16 indicates identity |
MQEALMSLMQMAK + 2 Deamidated (NQ); 2 Oxidation (M) |
| 3873 |
684.3109 | 1366.6073 | 1366.5857 | 15.8 | 0 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
EQQLEVMTGCR + Deamidated (NQ); Oxidation (M) |
| 155 |
387.1759 | 1544.6744 | 1544.6705 | 2.55 | 0 | 5 | 0.84 | 1Score > 16 indicates identity |
QDDAMVAFQNFIK + 3 Deamidated (NQ); Oxidation (M) |
| 896 |
454.7066 | 907.3986 | 907.3817 | 18.6 | 1 | 5 | 1.1 | 1Score > 17 indicates identity |
RDNQAMR + 2 Deamidated (NQ); Oxidation (M) |
| 2780 |
603.2741 | 1806.8005 | 1806.8314 | -17.1 | 0 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
TVAAEMPAMQCLQLAR + 2 Deamidated (NQ); Oxidation (M) |
| 504 |
414.1881 | 1239.5426 | 1239.5367 | 4.73 | 0 | 5 | 1.6 | 1Score > 19 indicates identity |
TEQQYENATR + Deamidated (NQ) |
| 600 |
427.6943 | 853.3741 | 853.3608 | 15.5 | 0 | 5 | 0.74 | 1Score > 16 indicates identity |
MMSQAMR |
| 3243 |
643.7925 | 1285.5705 | 1285.5795 | -6.95 | 0 | 5 | 1.4 | 1Score > 18 indicates identity |
MVTNLYQNMR + Deamidated (NQ); Oxidation (M) |
| 4886 |
765.3478 | 3057.3620 | 3057.3972 | -11.5 | 0 | 5 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
MANWLNQLQSLLGQSSSSTSSSADQGLVK + 5 Deamidated (NQ); Oxidation (M) |
| 1460 |
495.2250 | 988.4354 | 988.4461 | -10.9 | 0 | 5 | 0.9 | 1Score > 20 indicates identity Score > 17 indicates homology |
VNADPESTR + Deamidated (NQ) |
| 1674 |
508.7311 | 2030.8955 | 2030.8747 | 10.2 | 1 | 5 | 0.95 | 1Score > 17 indicates identity |
RFGMMLGQGMDVQSAQEK + 3 Deamidated (NQ); Oxidation (M) |
| 1381 |
495.2250 | 1482.6531 | 1482.6748 | -14.6 | 0 | 5 | 0.55 | 1Score > 20 indicates identity Score > 14 indicates homology |
AFEVGCTLNWMR |
| 2533 |
576.2618 | 1150.5091 | 1150.5288 | -17.1 | 0 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
TGDIMTIGGNR + Deamidated (NQ); Oxidation (M) |
| 888 |
454.7066 | 907.3986 | 907.3891 | 10.4 | 0 | 5 | 1.1 | 1Score > 17 indicates identity |
DMAMNQAK |
| 596 |
427.6943 | 853.3741 | 853.3851 | -13.0 | 0 | 5 | 0.75 | 1Score > 16 indicates identity |
GEMSTVSK + Oxidation (M) |
| 6712 |
913.9153 | 1825.8160 | 1825.8087 | 4.01 | 1 | 5 | 1.6 | 1Score > 19 indicates identity |
NGMECGIGVKNYNDVR + Deamidated (NQ) |
| 6210 |
873.3969 | 3489.5585 | 3489.6279 | -19.9 | 0 | 5 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
EGQHLMLEIEDNAGLYQPVTNASGLGMNLVDK + 2 Deamidated (NQ); 2 Oxidation (M) |
| 489 |
414.1881 | 1239.5426 | 1239.5441 | -1.22 | 0 | 5 | 1.6 | 1Score > 19 indicates identity |
AYCNLNEGIGK + 2 Deamidated (NQ) |
| 972 |
454.7066 | 1814.7972 | 1814.8179 | -11.4 | 1 | 5 | 1.1 | 1Score > 17 indicates identity |
ALTFCEAEMDNLTRK + Deamidated (NQ); Oxidation (M) |
| 1450 |
495.2250 | 988.4354 | 988.4219 | 13.7 | 0 | 5 | 0.65 | 1Score > 20 indicates identity Score > 15 indicates homology |
GNHEVMMR + Oxidation (M) |
| 3754 |
684.3109 | 2049.9109 | 2049.9500 | -19.0 | 1 | 5 | 0.41 | 1Score > 20 indicates identity Score > 13 indicates homology |
QDAVQHAQQLLKMMGYGV + 2 Deamidated (NQ); 2 Oxidation (M) |
| 1519 |
495.2250 | 1482.6531 | 1482.6443 | 5.96 | 1 | 5 | 0.57 | 1Score > 20 indicates identity Score > 15 indicates homology |
MSGDNGMTEEKLR + Oxidation (M) |
| 4448 |
738.3355 | 1474.6565 | 1474.6582 | -1.21 | 1 | 5 | 0.89 | 1Score > 20 indicates identity Score > 17 indicates homology |
AECQNQQGNLRR + 2 Deamidated (NQ) |
| 2433 |
576.2618 | 1725.7637 | 1725.7707 | -4.04 | 1 | 5 | 0.97 | 1Score > 20 indicates identity Score > 17 indicates homology |
YHVNQYTGDESRTR + Deamidated (NQ) |
| 1058 |
468.2127 | 1401.6163 | 1401.6194 | -2.24 | 0 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
TLPPGCEGEEASR |
| 2089 |
549.2496 | 2192.9692 | 2193.0017 | -14.8 | 1 | 5 | 0.57 | 1Score > 20 indicates identity Score > 15 indicates homology |
IAFVCDAGMGSSAMGATTFRK + Oxidation (M) |
| 2239 |
562.7557 | 1123.4968 | 1123.5179 | -18.8 | 0 | 5 | 1.3 | 1Score > 18 indicates identity |
SASLSDIEMR + Oxidation (M) |
| 4779 |
765.3478 | 3057.3620 | 3057.3994 | -12.2 | 1 | 5 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
FASYLIAAVQQATNGHCAICETMAQKR + 3 Deamidated (NQ); Oxidation (M) |
| 5784 |
846.3846 | 2536.1319 | 2536.1322 | -0.10 | 0 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
AASMITESQCYQLEQNLHQQR + 2 Deamidated (NQ) |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/