MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 4 Dec 2025 at 15:28:39 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 301–400 (out of 7566)

Page: Previous 1 2 3 4 5 6 7 8 9 … 76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
1079 468.2127 1401.6163 1401.6160 0.18 0 6 0.28 +1Score > 20 indicates identity
Score > 13 indicates homology		 YPHQLSGGQQQR + 4 Deamidated (NQ)
1114 468.2127 1868.8217 1868.8502 -15.2 0 6 0.97 +1Score > 20 indicates identity
Score > 19 indicates homology		 QYGIDAIGFNAPDLNMK + 3 Deamidated (NQ)
5093 792.3600 3165.4111 3165.3487 19.7 1 6 1 +1Score > 21 indicates identity
Score > 19 indicates homology		 FGKTATFMPKPMFGDNGSGMHCHMSLSK + Deamidated (NQ); 4 Oxidation (M)
6080 859.8907 1717.7669 1717.8006 -19.6 1 6 0.92 +1Score > 18 indicates identity SQILDEAKAEAEQER + 2 Deamidated (NQ)
1118 468.2127 934.4109 934.4257 -15.8 0 6 1 +1Score > 20 indicates identity
Score > 19 indicates homology		 EINQHHR + 2 Deamidated (NQ)
94 387.1759 772.3372 772.3351 2.67 0 6 0.6 +1Score > 16 indicates identity AQGEDPR + Deamidated (NQ)
974 454.7066 1814.7972 1814.7788 10.1 0 6 0.77 +1Score > 17 indicates identity DFPAVPYSGWDFNDGK + Deamidated (NQ)
7039 940.9276 1879.8405 1879.8188 11.6 1 6 1.2 +1Score > 19 indicates identity QVEGMFVQMMLKSMR + 2 Deamidated (NQ); 4 Oxidation (M)
6372 886.9030 1771.7915 1771.8224 -17.5 0 6 1.1 +1Score > 19 indicates identity VQTEVAQLSDDDPQAR + Deamidated (NQ)
509 414.1881 1652.7235 1652.7320 -5.18 1 6 1.2 +1Score > 19 indicates identity CVELVREMMGEQR + Deamidated (NQ); Oxidation (M)
2774 603.2741 1204.5337 1204.5281 4.60 0 6 0.51 +1Score > 20 indicates identity
Score > 16 indicates homology		 MEQNPQSQLK + 3 Deamidated (NQ)
1135 468.2127 934.4109 934.4192 -8.88 0 6 0.4 +1Score > 20 indicates identity
Score > 15 indicates homology		 HHSPACAR
5126 792.3600 1582.7055 1582.7263 -13.1 0 6 0.39 +1Score > 21 indicates identity
Score > 14 indicates homology		 DGQVYNIAFENGEK
5490 819.3723 1636.7301 1636.7515 -13.1 1 6 0.41 +1Score > 21 indicates identity
Score > 15 indicates homology		 CEWISNNGTSIRAK + 2 Deamidated (NQ)
431 414.1881 1652.7235 1652.7253 -1.09 0 6 1.2 +1Score > 19 indicates identity CWQEEAYAEAQLR
218 400.6820 799.3495 799.3422 9.09 0 6 0.57 +1Score > 16 indicates identity FTQMQK + 2 Deamidated (NQ); Oxidation (M)
140 387.1759 1544.6744 1544.6889 -9.41 0 6 0.63 +1Score > 16 indicates identity QAGCTLHEVGTTNR + 2 Deamidated (NQ)
1642 508.7311 1015.4477 1015.4611 -13.1 0 6 0.71 +1Score > 17 indicates identity YYDAETVR
1783 522.2372 2084.9199 2084.9507 -14.8 0 6 1.3 +1Score > 19 indicates identity DAHMEANLEMEIVPQGLR + Deamidated (NQ); 2 Oxidation (M)
3945 697.8171 1393.6196 1393.6296 -7.17 1 6 1.2 +1Score > 19 indicates identity LNFDPNGKMSDR + Deamidated (NQ)
2303 562.7557 1123.4968 1123.5179 -18.8 0 6 0.98 +1Score > 18 indicates identity SASLSDIEMR + Oxidation (M)
219 400.6820 799.3495 799.3460 4.28 0 6 0.59 +1Score > 16 indicates identity ATDDHNK
6850 927.4214 3705.6567 3705.6830 -7.10 1 6 1 +1Score > 21 indicates identity
Score > 18 indicates homology		 VMLNEKESAPQLCHHCEDAPCAVVCPVNAITR + Deamidated (NQ)
1902 535.7434 1069.4723 1069.4750 -2.56 0 6 0.85 +1Score > 18 indicates identity CSTGQFLEK + Deamidated (NQ)
599 427.6943 853.3741 853.3600 16.5 0 6 0.56 +1Score > 16 indicates identity MTSSAGQR + Deamidated (NQ); Oxidation (M)
825 441.2004 1320.5795 1320.5979 -14.0 0 6 1 +1Score > 20 indicates identity
Score > 18 indicates homology		 MAENQSTVENAK
1075 468.2127 1401.6163 1401.6160 0.18 0 6 0.64 +1Score > 20 indicates identity
Score > 16 indicates homology		 YPHQLSGGQQQR + 4 Deamidated (NQ)
3107 630.2864 2517.1164 2517.0722 17.5 1 6 0.56 +1Score > 20 indicates identity
Score > 16 indicates homology		 NNYIHDLDMAAERMFTESGMR + Deamidated (NQ); Oxidation (M)
3292 643.7925 1285.5705 1285.5682 1.79 0 6 1 +1Score > 18 indicates identity YAVNELMMDGK + Oxidation (M)
497 414.1881 1239.5426 1239.5661 -19.0 0 6 1.2 +1Score > 19 indicates identity SPMELMTMLR + 2 Oxidation (M)
1094 468.2127 1401.6163 1401.6235 -5.11 1 6 1 +1Score > 20 indicates identity
Score > 18 indicates homology		 NGGVKQFFMNDK + 2 Deamidated (NQ); Oxidation (M)
1239 481.7188 961.4231 961.4352 -12.6 0 6 0.92 +1Score > 18 indicates identity VNDQEISR + 2 Deamidated (NQ)
2255 562.7557 2246.9936 2246.9606 14.7 0 6 0.99 +1Score > 18 indicates identity HNIEAQHMTIDTNGQMVMK + 2 Deamidated (NQ); 3 Oxidation (M)
7128 954.4337 1906.8529 1906.8706 -9.30 0 6 1 +1Score > 21 indicates identity
Score > 18 indicates homology		 FIGFDYGTANCSVAVMR
901 454.7066 907.3986 907.3817 18.6 1 6 0.84 +1Score > 17 indicates identity RDNQAMR + 2 Deamidated (NQ); Oxidation (M)
641 427.6943 1706.7481 1706.7649 -9.84 0 6 0.57 +1Score > 16 indicates identity GSLGGGFSSGGFSGGSFSR
1349 481.7188 961.4231 961.4063 17.6 0 6 0.94 +1Score > 18 indicates identity METPQPDK + Deamidated (NQ); Oxidation (M)
1161 468.2127 1868.8217 1868.8019 10.6 0 6 1 +1Score > 20 indicates identity
Score > 18 indicates homology		 DLTANTMPGSNDIMEVK + 2 Deamidated (NQ); 2 Oxidation (M)
4756 765.3478 2293.0215 2293.0267 -2.27 1 6 1 +1Score > 21 indicates identity
Score > 18 indicates homology		 MDTGKIADALINEAQQDLQSN + 3 Deamidated (NQ); Oxidation (M)
5133 792.3600 1582.7055 1582.6821 14.8 0 6 1 +1Score > 21 indicates identity
Score > 18 indicates homology		 CDLQNYGDSATLPK + 2 Deamidated (NQ)
133 387.1759 1158.5058 1158.4829 19.8 0 6 0.66 +1Score > 16 indicates identity YFQSDNAADK + Deamidated (NQ)
2225 562.7557 1123.4968 1123.5067 -8.80 0 6 1 +1Score > 18 indicates identity QQETAVATMK + 2 Deamidated (NQ); Oxidation (M)
3976 697.8171 1393.6196 1393.6395 -14.3 1 6 1.3 +1Score > 19 indicates identity LMKGDDESIENK + Oxidation (M)
3910 697.8171 2787.2392 2787.2520 -4.59 0 6 1.3 +1Score > 19 indicates identity AGIPLDVMYDVVTNAAGNSWMFENR + 2 Deamidated (NQ); Oxidation (M)
5121 792.3600 1582.7055 1582.7045 0.64 1 6 0.34 +1Score > 21 indicates identity
Score > 13 indicates homology		 CQYETLVENNRR + 2 Deamidated (NQ)
62 387.1759 1158.5058 1158.5267 -18.0 0 6 0.67 +1Score > 16 indicates identity EAYELFMEK
3018 616.7802 2463.0917 2463.0987 -2.84 1 6 1 +1Score > 18 indicates identity GKVMLFGHWDNECEIPDPYR + Deamidated (NQ)
1389 495.2250 1482.6531 1482.6660 -8.73 0 6 0.47 +1Score > 20 indicates identity
Score > 15 indicates homology		 MYGDDLLGDEIAR + Oxidation (M)
7327 967.9399 1933.8652 1933.8705 -2.72 1 6 1.3 +1Score > 19 indicates identity IMCAFKMMATCSNVVR + Oxidation (M)
1459 495.2250 1482.6531 1482.6409 8.26 1 6 1 +1Score > 20 indicates identity
Score > 18 indicates homology		 NKQNDLQAMHHK + 4 Deamidated (NQ); Oxidation (M)
4255 724.8293 2895.2883 2895.2803 2.75 1 6 1.1 +1Score > 18 indicates identity FDNSRYNGILNQMGMTADQYAQALR + 3 Deamidated (NQ); Oxidation (M)
3263 643.7925 1285.5705 1285.5826 -9.42 0 6 1.1 +1Score > 18 indicates identity ADGAYLYDVDGK
2742 603.2741 1204.5337 1204.5281 4.60 0 6 0.41 +1Score > 20 indicates identity
Score > 14 indicates homology		 MEQNPQSQLK + 3 Deamidated (NQ)
4520 738.3355 1474.6565 1474.6510 3.68 1 6 1 +1Score > 20 indicates identity
Score > 18 indicates homology		 QWENGKCAIPDR + 2 Deamidated (NQ)
2319 562.7557 1123.4968 1123.5067 -8.80 0 5 1.1 +1Score > 18 indicates identity QQETAVATMK + 2 Deamidated (NQ); Oxidation (M)
2781 603.2741 1204.5337 1204.5394 -4.76 0 5 1 +1Score > 20 indicates identity
Score > 18 indicates homology		 DDPSMVADLSR
3663 670.8048 2679.1901 2679.2349 -16.7 0 5 1.3 +1Score > 19 indicates identity TVYNQPANMFVSGFIGSPAMNFIR + 3 Deamidated (NQ); Oxidation (M)
4071 697.8171 1393.6196 1393.6031 11.9 0 5 1.4 +1Score > 19 indicates identity TEQVNQQLMER + 3 Deamidated (NQ); Oxidation (M)
1168 468.2127 1868.8217 1868.7954 14.1 0 5 1 +1Score > 20 indicates identity
Score > 18 indicates homology		 MQAVIDGMEMDLDQTR + Deamidated (NQ); Oxidation (M)
5064 778.8539 1555.6932 1555.7049 -7.52 1 5 1.1 +1Score > 18 indicates identity SSMTLGAGGSSPSHKH + Oxidation (M)
6509 900.4092 3597.6076 3597.5545 14.8 0 5 1 +1Score > 20 indicates identity
Score > 18 indicates homology		 GSMAMAAVCGTSGIASLFSQAAFAADSDIADGQTQR + 3 Deamidated (NQ); 2 Oxidation (M)
1426 495.2250 1976.8708 1976.8996 -14.6 0 5 0.43 +1Score > 20 indicates identity
Score > 14 indicates homology		 AASEEVINMLSQANPQTR + 3 Deamidated (NQ); Oxidation (M)
7049 940.9276 1879.8405 1879.8145 13.8 0 5 1.3 +1Score > 19 indicates identity ASDLANMLLQDAGWNDK + 3 Deamidated (NQ); Oxidation (M)
375 414.1881 826.3617 826.3677 -7.23 0 5 1.3 +1Score > 19 indicates identity MATVSMR + 2 Oxidation (M)
409 414.1881 1239.5426 1239.5661 -19.0 0 5 1.3 +1Score > 19 indicates identity SPMELMTMLR + 2 Oxidation (M)
1386 495.2250 988.4354 988.4219 13.7 0 5 1 +1Score > 20 indicates identity
Score > 18 indicates homology		 GNHEVMMR + Oxidation (M)
2286 562.7557 1123.4968 1123.5179 -18.8 0 5 1.1 +1Score > 18 indicates identity SASLSDIEMR + Oxidation (M)
5468 819.3723 1636.7301 1636.7120 11.1 1 5 0.41 +1Score > 21 indicates identity
Score > 14 indicates homology		 AMDCADRLMPAQSR + Oxidation (M)
5829 846.3846 1690.7546 1690.7403 8.47 0 5 0.42 +1Score > 20 indicates identity
Score > 14 indicates homology		 SEMGDLAQSVSHMQR + Oxidation (M)
310 400.6820 799.3495 799.3573 -9.77 0 5 0.65 +1Score > 16 indicates identity HAGNSGTR + Deamidated (NQ)
2879 603.2741 1204.5337 1204.5281 4.60 0 5 0.35 +1Score > 20 indicates identity
Score > 13 indicates homology		 MEQNPQSQLK + 3 Deamidated (NQ)
3589 670.8048 1339.5951 1339.6190 -17.9 1 5 1.4 +1Score > 19 indicates identity ANREMIFADTR + Deamidated (NQ); Oxidation (M)
7196 954.4337 3813.7058 3813.6848 5.50 0 5 0.91 +1Score > 21 indicates identity
Score > 17 indicates homology		 LEAGMNLYGQEMDETISPLAANMGWTIAWEPADR + 2 Deamidated (NQ); 2 Oxidation (M)
1232 481.7188 961.4231 961.4215 1.67 0 5 1 +1Score > 18 indicates identity GSMTFFEK + Oxidation (M)
2512 576.2618 1150.5091 1150.5176 -7.36 0 5 1 +1Score > 20 indicates identity
Score > 18 indicates homology		 ADDTMNIGGIK + Deamidated (NQ); Oxidation (M)
3291 643.7925 1285.5705 1285.5795 -6.95 0 5 1.2 +1Score > 18 indicates identity MVTNLYQNMR + Deamidated (NQ); Oxidation (M)
7556 980.1954 2937.5645 2937.5308 11.5 1 5 1.1 +1Score > 18 indicates identity QTFQADLAIVGAGGAGLRAAIAAAQANPNAK + 2 Deamidated (NQ)
1404 495.2250 988.4354 988.4219 13.7 0 5 1 +1Score > 20 indicates identity
Score > 18 indicates homology		 GNHEVMMR + Oxidation (M)
1215 481.7188 961.4231 961.4352 -12.6 0 5 1 +1Score > 18 indicates identity TENLQAER + 2 Deamidated (NQ)
2173 549.2496 1096.4846 1096.4893 -4.25 1 5 0.55 +1Score > 20 indicates identity
Score > 15 indicates homology		 SMKVMENDK + Oxidation (M)
5783 846.3846 2536.1319 2536.1322 -0.10 0 5 1 +1Score > 20 indicates identity
Score > 18 indicates homology		 AASMITESQCYQLEQNLHQQR + 2 Deamidated (NQ)
5827 846.3846 1690.7546 1690.7403 8.47 0 5 0.39 +1Score > 20 indicates identity
Score > 14 indicates homology		 SEMGDLAQSVSHMQR + Oxidation (M)
245 400.6820 799.3495 799.3460 4.28 0 5 0.67 +1Score > 16 indicates identity ATDDHNK
240 400.6820 799.3495 799.3460 4.28 0 5 0.67 +1Score > 16 indicates identity ATDDHNK
369 414.1881 826.3617 826.3643 -3.15 1 5 1.4 +1Score > 19 indicates identity RDDMFK + Oxidation (M)
4125 711.3232 2130.9479 2130.9384 4.47 1 5 0.38 +1Score > 21 indicates identity
Score > 14 indicates homology		 QDMACLIREYQEVMNSK + Deamidated (NQ); Oxidation (M)
1652 508.7311 1015.4477 1015.4458 1.91 0 5 0.83 +1Score > 17 indicates identity GNNQPDIQK + 3 Deamidated (NQ)
1770 522.2372 2084.9199 2084.9176 1.07 1 5 1.5 +1Score > 19 indicates identity MTTLNCSGQCRLQAVEAK + 3 Deamidated (NQ); Oxidation (M)
551 427.6943 1706.7481 1706.7649 -9.84 0 5 0.65 +1Score > 16 indicates identity GSLGGGFSSGGFSGGSFSR
1129 468.2127 934.4109 934.4178 -7.41 0 5 0.59 +1Score > 20 indicates identity
Score > 15 indicates homology		 NAALNEMR + Deamidated (NQ); Oxidation (M)
1826 522.2372 1042.4599 1042.4502 9.37 1 5 1.5 +1Score > 19 indicates identity ESFSNMRR + Deamidated (NQ); Oxidation (M)
429 414.1881 1239.5426 1239.5661 -19.0 0 5 1.4 +1Score > 19 indicates identity SPMELMTMLR + 2 Oxidation (M)
5034 778.8539 1555.6932 1555.7123 -12.3 1 5 1.2 +1Score > 18 indicates identity ATRAQAGDFMSLCK + Deamidated (NQ)
619 427.6943 853.3741 853.3674 7.85 0 5 0.66 +1Score > 16 indicates identity VMNMQAK + Deamidated (NQ); 2 Oxidation (M)
2451 576.2618 1725.7637 1725.7767 -7.53 1 5 1 +1Score > 20 indicates identity
Score > 18 indicates homology		 EKQSLEQGAMQPSFK + 3 Deamidated (NQ); Oxidation (M)
5113 792.3600 1582.7055 1582.7045 0.64 1 5 1 +1Score > 21 indicates identity
Score > 18 indicates homology		 CQYETLVENNRR + 2 Deamidated (NQ)
3884 684.3109 2049.9109 2049.9136 -1.29 0 5 1 +1Score > 20 indicates identity
Score > 18 indicates homology		 MLDMGFAQDIEHIAGETR + Deamidated (NQ); Oxidation (M)
6165 873.3969 1744.7793 1744.8050 -14.8 0 5 1 +1Score > 22 indicates identity
Score > 18 indicates homology		 VACDVTNPLVGDNGASR + Deamidated (NQ)
298 400.6820 799.3495 799.3501 -0.74 0 5 0.69 +1Score > 16 indicates identity YPDYSR
2758 603.2741 1204.5337 1204.5394 -4.73 0 5 0.57 +1Score > 20 indicates identity
Score > 15 indicates homology		 ADCEQLAELR + Deamidated (NQ)
Page: Previous 1 2 3 4 5 6 7 8 9 … 76 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/