MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | test |
| MS data file | : | PRT1346_ENIGMA_14.mgf |
| Database | : | Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues) |
| Timestamp | : | 4 Dec 2025 at 15:28:39 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 7,621 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 929 |
454.7066 | 1814.7972 | 1814.7781 | 10.5 | 1 | 8 | 0.55 | 1Score > 17 indicates identity |
NMTFSKDDWQTQEGK + Deamidated (NQ) |
| 132 |
387.1759 | 1158.5058 | 1158.5267 | -18.0 | 0 | 8 | 0.43 | 1Score > 16 indicates identity |
FMAQYQELK + 2 Deamidated (NQ) |
| 5700 |
832.8785 | 1663.7424 | 1663.7487 | -3.76 | 1 | 8 | 0.83 | 1Score > 19 indicates identity |
ASETFMYARAMGWK + Oxidation (M) |
| 1127 |
468.2127 | 1868.8217 | 1868.8502 | -15.2 | 0 | 8 | 0.32 | 1Score > 20 indicates identity Score > 15 indicates homology |
QYGIDAIGFNAPDLNMK + 3 Deamidated (NQ) |
| 1498 |
495.2250 | 988.4354 | 988.4219 | 13.7 | 0 | 8 | 0.94 | 1Score > 20 indicates identity |
GNHEVMMR + Oxidation (M) |
| 3439 |
657.2986 | 1968.8741 | 1968.8499 | 12.3 | 0 | 7 | 0.85 | 1Score > 21 indicates identity Score > 19 indicates homology |
CFADIQPMTDEFGWPR |
| 778 |
441.2004 | 1320.5795 | 1320.5793 | 0.14 | 1 | 7 | 0.42 | 1Score > 20 indicates identity Score > 16 indicates homology |
ADAEKAEETSNR + Deamidated (NQ) |
| 2345 |
562.7557 | 2246.9936 | 2247.0055 | -5.28 | 1 | 7 | 0.68 | 1Score > 18 indicates identity |
YYEPSPGRNYGVGMNIAWR + 2 Deamidated (NQ); Oxidation (M) |
| 451 |
414.1881 | 1239.5426 | 1239.5661 | -19.0 | 0 | 7 | 0.86 | 1Score > 19 indicates identity |
SPMELMTMLR + 2 Oxidation (M) |
| 966 |
454.7066 | 1814.7972 | 1814.7849 | 6.80 | 0 | 7 | 0.58 | 1Score > 17 indicates identity |
MTSSCCVTNNLQASLK + 2 Deamidated (NQ) |
| 2355 |
562.7557 | 1123.4968 | 1123.5179 | -18.8 | 0 | 7 | 0.69 | 1Score > 18 indicates identity |
SASLSDIEMR + Oxidation (M) |
| 445 |
414.1881 | 1652.7235 | 1652.7278 | -2.62 | 0 | 7 | 0.87 | 1Score > 19 indicates identity |
AYSGEGAIADDAGNVSR + Deamidated (NQ) |
| 6497 |
900.4092 | 3597.6076 | 3597.6790 | -19.8 | 0 | 7 | 0.32 | 1Score > 20 indicates identity Score > 15 indicates homology |
IDVMLDSDGQFYLLEANTSPGMTSHSLVPMAAR + 2 Oxidation (M) |
| 1384 |
495.2250 | 1976.8708 | 1976.8996 | -14.6 | 0 | 7 | 0.31 | 1Score > 20 indicates identity Score > 15 indicates homology |
AASEEVINMLSQANPQTR + 3 Deamidated (NQ); Oxidation (M) |
| 837 |
441.2004 | 1320.5795 | 1320.6058 | -19.9 | 1 | 7 | 1 | 1Score > 20 indicates identity Score > 20 indicates homology |
DNNRVGFAEAAR + 2 Deamidated (NQ) |
| 452 |
414.1881 | 1239.5426 | 1239.5661 | -19.0 | 0 | 7 | 0.88 | 1Score > 19 indicates identity |
SPMELMTMLR + 2 Oxidation (M) |
| 1163 |
468.2127 | 934.4109 | 934.4219 | -11.8 | 0 | 7 | 0.27 | 1Score > 20 indicates identity Score > 14 indicates homology |
TFPDCAPK |
| 2828 |
603.2741 | 1204.5337 | 1204.5394 | -4.76 | 0 | 7 | 0.58 | 1Score > 20 indicates identity Score > 17 indicates homology |
DDPSMVADLSR |
| 412 |
414.1881 | 1239.5426 | 1239.5661 | -19.0 | 0 | 7 | 0.89 | 1Score > 19 indicates identity |
SPMELMTMLR + 2 Oxidation (M) |
| 257 |
400.6820 | 1598.6989 | 1598.7186 | -12.3 | 1 | 7 | 0.43 | 1Score > 16 indicates identity |
GGQHSGGNFKNDPQR + Deamidated (NQ) |
| 2520 |
576.2618 | 1150.5091 | 1150.5288 | -17.1 | 0 | 7 | 1 | 1Score > 20 indicates identity Score > 20 indicates homology |
TGDIMTIGGNR + Deamidated (NQ); Oxidation (M) |
| 2628 |
589.7679 | 2355.0427 | 2355.0280 | 6.24 | 1 | 7 | 0.83 | 1Score > 19 indicates identity |
GEHHGQKGFFAWFNQMFNR + 2 Deamidated (NQ); Oxidation (M) |
| 482 |
414.1881 | 826.3617 | 826.3643 | -3.15 | 1 | 7 | 0.91 | 1Score > 19 indicates identity |
RDDMFK + Oxidation (M) |
| 533 |
427.6943 | 853.3741 | 853.3608 | 15.5 | 0 | 7 | 0.42 | 1Score > 16 indicates identity |
MMSQAMR |
| 838 |
441.2004 | 1320.5795 | 1320.6058 | -19.9 | 1 | 7 | 0.28 | 1Score > 20 indicates identity Score > 14 indicates homology |
DNNRVGFAEAAR + 2 Deamidated (NQ) |
| 2929 |
616.7802 | 1231.5459 | 1231.5431 | 2.28 | 0 | 7 | 0.71 | 1Score > 18 indicates identity |
TNFNFAIMEK + 2 Deamidated (NQ); Oxidation (M) |
| 3421 |
657.2986 | 1312.5827 | 1312.5686 | 10.8 | 1 | 7 | 0.63 | 1Score > 21 indicates identity Score > 18 indicates homology |
IMDRMTMNGGR + 2 Oxidation (M) |
| 3816 |
684.3109 | 2733.2145 | 2733.2567 | -15.4 | 0 | 7 | 1 | 1Score > 20 indicates identity Score > 20 indicates homology |
FTGGSVQVFHGMAAYFGLPEALMNR + 2 Deamidated (NQ); 2 Oxidation (M) |
| 303 |
400.6820 | 1598.6989 | 1598.7001 | -0.74 | 0 | 7 | 0.45 | 1Score > 16 indicates identity |
FANSLFVNNWDNR + 3 Deamidated (NQ) |
| 2113 |
549.2496 | 2192.9692 | 2192.9896 | -9.29 | 0 | 7 | 0.82 | 1Score > 20 indicates identity Score > 19 indicates homology |
EAVLCEWTETVNTPSAQTR + 2 Deamidated (NQ) |
| 450 |
414.1881 | 1239.5426 | 1239.5661 | -19.0 | 0 | 7 | 0.94 | 1Score > 19 indicates identity |
MIMAMVQDIR + Deamidated (NQ); 2 Oxidation (M) |
| 2740 |
603.2741 | 1204.5337 | 1204.5281 | 4.60 | 0 | 7 | 0.23 | 1Score > 20 indicates identity Score > 13 indicates homology |
MEQNPQSQLK + 3 Deamidated (NQ) |
| 4357 |
724.8293 | 2895.2883 | 2895.2691 | 6.62 | 1 | 7 | 0.77 | 1Score > 18 indicates identity |
AIDSISNGYTYFDSVHMDCEKISSR + Deamidated (NQ) |
| 7178 |
954.4337 | 1906.8529 | 1906.8513 | 0.82 | 1 | 7 | 0.28 | 1Score > 21 indicates identity Score > 14 indicates homology |
DDVNEVRNGMECGIGVK + Oxidation (M) |
| 979 |
454.7066 | 1814.7972 | 1814.8219 | -13.6 | 0 | 7 | 0.64 | 1Score > 17 indicates identity |
VINGFMIQGGGFEPGMK + 2 Deamidated (NQ); 2 Oxidation (M) |
| 2836 |
603.2741 | 1806.8005 | 1806.8314 | -17.1 | 0 | 7 | 0.86 | 1Score > 20 indicates identity Score > 19 indicates homology |
TVAAEMPAMQCLQLAR + 2 Deamidated (NQ); Oxidation (M) |
| 70 |
387.1759 | 772.3372 | 772.3464 | -11.9 | 0 | 7 | 0.51 | 1Score > 16 indicates identity |
NNPDGTR |
| 2778 |
603.2741 | 1204.5337 | 1204.5281 | 4.60 | 0 | 7 | 0.58 | 1Score > 20 indicates identity Score > 17 indicates homology |
MEQNPQSQLK + 3 Deamidated (NQ) |
| 3265 |
643.7925 | 1285.5705 | 1285.5609 | 7.53 | 0 | 7 | 0.82 | 1Score > 18 indicates identity |
DNGAEYTMTLR + Oxidation (M) |
| 1788 |
522.2372 | 1563.6899 | 1563.6844 | 3.55 | 0 | 7 | 1 | 1Score > 19 indicates identity |
MICSPQNNTGAPMK + Oxidation (M) |
| 1799 |
522.2372 | 1042.4599 | 1042.4502 | 9.37 | 1 | 7 | 1 | 1Score > 19 indicates identity |
ESFSNMRR + Deamidated (NQ); Oxidation (M) |
| 4109 |
711.3232 | 1420.6319 | 1420.6331 | -0.82 | 0 | 7 | 0.25 | 1Score > 21 indicates identity Score > 13 indicates homology |
HNGGQVIHSADER + 2 Deamidated (NQ) |
| 324 |
400.6820 | 1598.6989 | 1598.7113 | -7.76 | 0 | 7 | 0.47 | 1Score > 16 indicates identity |
EHEHEIAWYTER |
| 2316 |
562.7557 | 2246.9936 | 2246.9606 | 14.7 | 0 | 7 | 0.78 | 1Score > 18 indicates identity |
HNIEAQHMTIDTNGQMVMK + 2 Deamidated (NQ); 3 Oxidation (M) |
| 335 |
400.6820 | 1598.6989 | 1598.6990 | -0.051 | 0 | 7 | 0.47 | 1Score > 16 indicates identity |
SDVTPALSEMMQMK + 2 Oxidation (M) |
| 1406 |
495.2250 | 1482.6531 | 1482.6806 | -18.6 | 0 | 7 | 0.29 | 1Score > 20 indicates identity Score > 14 indicates homology |
MVNSGTEATMSAIR + Oxidation (M) |
| 7508 |
980.1954 | 3916.7526 | 3916.7598 | -1.83 | 1 | 7 | 0.78 | 1Score > 18 indicates identity |
GSGIHVVSNQPRHQQAADNNMEFANYGPFELLQAR + 6 Deamidated (NQ); Oxidation (M) |
| 1131 |
468.2127 | 934.4109 | 934.4178 | -7.41 | 0 | 7 | 1 | 1Score > 20 indicates identity Score > 19 indicates homology |
NAALNEMR + Deamidated (NQ); Oxidation (M) |
| 231 |
400.6820 | 799.3495 | 799.3573 | -9.77 | 0 | 7 | 0.47 | 1Score > 16 indicates identity |
HAGNSGTR + Deamidated (NQ) |
| 376 |
414.1881 | 1239.5426 | 1239.5553 | -10.3 | 1 | 7 | 1 | 1Score > 19 indicates identity |
QKMAENNGGYK + Deamidated (NQ) |
| 6947 |
940.9276 | 1879.8405 | 1879.8384 | 1.16 | 1 | 7 | 1 | 1Score > 19 indicates identity |
YVMLHGVNRHDNDHR + 2 Deamidated (NQ); Oxidation (M) |
| 1141 |
468.2127 | 1401.6163 | 1401.6082 | 5.79 | 1 | 7 | 0.68 | 1Score > 20 indicates identity Score > 18 indicates homology |
TATADNKSMFNGK + 2 Deamidated (NQ); Oxidation (M) |
| 1146 |
468.2127 | 934.4109 | 934.4290 | -19.5 | 1 | 7 | 1 | 1Score > 20 indicates identity Score > 19 indicates homology |
DCSLQRR + Deamidated (NQ) |
| 1267 |
481.7188 | 961.4231 | 961.4141 | 9.40 | 0 | 7 | 0.76 | 1Score > 18 indicates identity |
NGWENNVK + 2 Deamidated (NQ) |
| 2510 |
576.2618 | 1150.5091 | 1150.4891 | 17.4 | 0 | 7 | 0.62 | 1Score > 20 indicates identity Score > 17 indicates homology |
DEAQEQQFR + Deamidated (NQ) |
| 127 |
387.1759 | 1544.6744 | 1544.7028 | -18.4 | 0 | 7 | 0.53 | 1Score > 16 indicates identity |
HAEQENMTLTELK + 2 Deamidated (NQ) |
| 394 |
414.1881 | 1239.5426 | 1239.5554 | -10.3 | 0 | 7 | 1 | 1Score > 19 indicates identity |
DGGTQFEVMTR |
| 150 |
387.1759 | 1544.6744 | 1544.6889 | -9.41 | 0 | 7 | 0.54 | 1Score > 16 indicates identity |
QAGCTLHEVGTTNR + 2 Deamidated (NQ) |
| 734 |
441.2004 | 880.3863 | 880.3709 | 17.5 | 0 | 7 | 1 | 1Score > 20 indicates identity Score > 19 indicates homology |
ATDSATCR |
| 1325 |
481.7188 | 1922.8463 | 1922.8778 | -16.4 | 0 | 7 | 0.77 | 1Score > 18 indicates identity |
SANMTLEQLESLNAEQK + 2 Deamidated (NQ); Oxidation (M) |
| 2280 |
562.7557 | 1123.4968 | 1123.4968 | 0.0036 | 0 | 7 | 0.82 | 1Score > 18 indicates identity |
HADTAMYTAK + Oxidation (M) |
| 7179 |
954.4337 | 1906.8529 | 1906.8883 | -18.6 | 0 | 7 | 0.44 | 1Score > 21 indicates identity Score > 16 indicates homology |
WSSQMINTLQIQFHR + 3 Deamidated (NQ); Oxidation (M) |
| 5390 |
805.8662 | 3219.4357 | 3219.4973 | -19.1 | 1 | 7 | 0.88 | 1Score > 19 indicates identity |
VAMMNRLQQALEHNHFFLMAQPITGMR + 4 Deamidated (NQ); 2 Oxidation (M) |
| 3169 |
630.2864 | 2517.1164 | 2517.1264 | -3.96 | 0 | 7 | 0.37 | 1Score > 20 indicates identity Score > 15 indicates homology |
ANGIEHSNAHDAMADVYATIAMAK + Deamidated (NQ); Oxidation (M) |
| 5369 |
805.8662 | 1609.7179 | 1609.7480 | -18.7 | 0 | 7 | 0.89 | 1Score > 19 indicates identity |
VFADTGENGVMMPVK + Oxidation (M) |
| 1167 |
468.2127 | 934.4109 | 934.4291 | -19.5 | 1 | 7 | 1 | 1Score > 20 indicates identity Score > 19 indicates homology |
DGMRVGER + Oxidation (M) |
| 624 |
427.6943 | 853.3741 | 853.3851 | -13.0 | 0 | 7 | 0.48 | 1Score > 16 indicates identity |
GEMSTVSK + Oxidation (M) |
| 230 |
400.6820 | 1598.6989 | 1598.6882 | 6.69 | 1 | 7 | 0.5 | 1Score > 16 indicates identity |
GDLSFMQRESDGEK + Deamidated (NQ) |
| 1352 |
481.7188 | 1922.8463 | 1922.8754 | -15.1 | 1 | 6 | 0.79 | 1Score > 18 indicates identity |
FMSRGYSMTQIAEQLK + 2 Deamidated (NQ); 2 Oxidation (M) |
| 1704 |
522.2372 | 2084.9199 | 2084.9585 | -18.5 | 0 | 6 | 1.1 | 1Score > 19 indicates identity |
LAVHSAMESLSYHPNANAR + 2 Deamidated (NQ); Oxidation (M) |
| 1570 |
508.7311 | 1015.4477 | 1015.4611 | -13.1 | 0 | 6 | 0.62 | 1Score > 17 indicates identity |
YYDAETVR |
| 5805 |
846.3846 | 1690.7546 | 1690.7403 | 8.47 | 0 | 6 | 1 | 1Score > 20 indicates identity Score > 19 indicates homology |
SEMGDLAQSVSHMQR + Oxidation (M) |
| 507 |
414.1881 | 1239.5426 | 1239.5666 | -19.4 | 1 | 6 | 1.1 | 1Score > 19 indicates identity |
QQFATMGERR + Deamidated (NQ); Oxidation (M) |
| 1750 |
522.2372 | 1563.6899 | 1563.7160 | -16.7 | 0 | 6 | 1.1 | 1Score > 19 indicates identity |
NLMDAIELEQMPK + Deamidated (NQ); 2 Oxidation (M) |
| 401 |
414.1881 | 1239.5426 | 1239.5661 | -19.0 | 0 | 6 | 1.1 | 1Score > 19 indicates identity |
SPMELMTMLR + 2 Oxidation (M) |
| 407 |
414.1881 | 826.3617 | 826.3643 | -3.13 | 0 | 6 | 1.1 | 1Score > 19 indicates identity |
MYVNQR + Deamidated (NQ); Oxidation (M) |
| 1275 |
481.7188 | 961.4231 | 961.4063 | 17.6 | 0 | 6 | 0.8 | 1Score > 18 indicates identity |
METPQPDK + Deamidated (NQ); Oxidation (M) |
| 1868 |
522.2372 | 1563.6899 | 1563.7126 | -14.5 | 0 | 6 | 1.1 | 1Score > 19 indicates identity |
NAMLPLENSDSPFK + 2 Deamidated (NQ) |
| 6449 |
900.4092 | 3597.6076 | 3597.6790 | -19.8 | 0 | 6 | 0.93 | 1Score > 20 indicates identity Score > 19 indicates homology |
IDVMLDSDGQFYLLEANTSPGMTSHSLVPMAAR + 2 Oxidation (M) |
| 366 |
414.1881 | 1652.7235 | 1652.7318 | -5.03 | 1 | 6 | 1.1 | 1Score > 19 indicates identity |
WYAERDAEIENEK + Deamidated (NQ) |
| 384 |
414.1881 | 1239.5426 | 1239.5554 | -10.3 | 0 | 6 | 1.1 | 1Score > 19 indicates identity |
DGGTQFEVMTR |
| 752 |
441.2004 | 880.3863 | 880.3709 | 17.5 | 0 | 6 | 0.69 | 1Score > 20 indicates identity Score > 17 indicates homology |
TQNMGGTR + Deamidated (NQ); Oxidation (M) |
| 1043 |
468.2127 | 1401.6163 | 1401.6194 | -2.24 | 0 | 6 | 1 | 1Score > 20 indicates identity Score > 19 indicates homology |
TLPPGCEGEEASR |
| 441 |
414.1881 | 1652.7235 | 1652.6956 | 16.8 | 1 | 6 | 1.1 | 1Score > 19 indicates identity |
CLMCQPASTQGNRK + 3 Deamidated (NQ) |
| 2431 |
576.2618 | 1725.7637 | 1725.7376 | 15.1 | 1 | 6 | 1 | 1Score > 20 indicates identity Score > 19 indicates homology |
EIFNMSNQRNGDQR + 2 Deamidated (NQ); Oxidation (M) |
| 3824 |
684.3109 | 1366.6073 | 1366.5857 | 15.8 | 0 | 6 | 1 | 1Score > 20 indicates identity Score > 19 indicates homology |
EQQLEVMTGCR + Deamidated (NQ); Oxidation (M) |
| 1492 |
495.2250 | 988.4354 | 988.4219 | 13.7 | 0 | 6 | 1 | 1Score > 20 indicates identity Score > 19 indicates homology |
GNHEVMMR + Oxidation (M) |
| 5821 |
846.3846 | 1690.7546 | 1690.7369 | 10.5 | 1 | 6 | 1 | 1Score > 20 indicates identity Score > 19 indicates homology |
QYYMNQQRTQSAR + 2 Deamidated (NQ); Oxidation (M) |
| 1096 |
468.2127 | 934.4109 | 934.4192 | -8.88 | 0 | 6 | 0.32 | 1Score > 20 indicates identity Score > 14 indicates homology |
HHSPACAR |
| 3692 |
670.8048 | 1339.5951 | 1339.6190 | -17.9 | 1 | 6 | 1.1 | 1Score > 19 indicates identity |
KDSGFQMNQLR + Deamidated (NQ); Oxidation (M) |
| 571 |
427.6943 | 853.3741 | 853.3600 | 16.5 | 0 | 6 | 0.51 | 1Score > 16 indicates identity |
MTSSAGQR + Deamidated (NQ); Oxidation (M) |
| 2851 |
603.2741 | 1806.8005 | 1806.8314 | -17.1 | 0 | 6 | 1 | 1Score > 20 indicates identity Score > 19 indicates homology |
TVAAEMPAMQCLQLAR + 2 Deamidated (NQ); Oxidation (M) |
| 4356 |
724.8293 | 2895.2883 | 2895.2691 | 6.62 | 1 | 6 | 0.9 | 1Score > 18 indicates identity |
AIDSISNGYTYFDSVHMDCEKISSR + Deamidated (NQ) |
| 4934 |
778.8539 | 1555.6932 | 1555.7049 | -7.50 | 0 | 6 | 0.92 | 1Score > 18 indicates identity |
EGHIQQQMGGINAR + 2 Deamidated (NQ); Oxidation (M) |
| 1512 |
495.2250 | 1482.6531 | 1482.6409 | 8.23 | 0 | 6 | 1 | 1Score > 20 indicates identity Score > 19 indicates homology |
FSSPGQMSGDSLNR + Deamidated (NQ) |
| 7188 |
954.4337 | 3813.7058 | 3813.6842 | 5.66 | 1 | 6 | 0.6 | 1Score > 21 indicates identity Score > 17 indicates homology |
IMTGAPVPEGCEAVVMQEQTEQMDNGVRFTAEVR + 3 Deamidated (NQ); 2 Oxidation (M) |
| 502 |
414.1881 | 1652.7235 | 1652.7273 | -2.32 | 0 | 6 | 1.1 | 1Score > 19 indicates identity |
EMVSEMVANDLEAAK + Deamidated (NQ); Oxidation (M) |
| 2727 |
603.2741 | 1204.5337 | 1204.5394 | -4.75 | 1 | 6 | 1 | 1Score > 20 indicates identity Score > 19 indicates homology |
GDLKNMNPDGK + Deamidated (NQ); Oxidation (M) |
| 1632 |
508.7311 | 1015.4477 | 1015.4619 | -14.0 | 0 | 6 | 0.66 | 1Score > 17 indicates identity |
FDMMGFLR |
| 311 |
400.6820 | 1598.6989 | 1598.7259 | -16.9 | 1 | 6 | 0.54 | 1Score > 16 indicates identity |
AWAQAAQCPPDRAR + 2 Deamidated (NQ) |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/