MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 4 Dec 2025 at 15:28:39 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1901–2000 (out of 7566)

Page: Previous 1 …15 16 17 18 19 20 21 22 23 24 25 … 76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
7373 967.9399 1933.8652 1933.8767 -5.95 1 0 4.6 +1Score > 19 indicates identity MLQLNENKQFAFFQR + 5 Deamidated (NQ); Oxidation (M)
7208 954.4337 2860.2793 2860.2639 5.40 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 TSLHFAMMQAQNNVLMMTGVSPSIGK + 4 Deamidated (NQ); 4 Oxidation (M)
275 400.6820 1598.6989 1598.7186 -12.3 1 0 2.2 +1Score > 16 indicates identity GGQHSGGNFKNDPQR + Deamidated (NQ)
416 414.1881 1652.7235 1652.7069 10.0 1 0 4.7 +1Score > 19 indicates identity RMGELMAESHASMR + 3 Oxidation (M)
506 414.1881 1239.5426 1239.5587 -13.0 1 0 4.7 +1Score > 19 indicates identity TLKEMAQSCR + Deamidated (NQ); Oxidation (M)
1505 495.2250 1482.6531 1482.6660 -8.73 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 MYGDDLLGDEIAR + Oxidation (M)
1722 522.2372 1563.6899 1563.6987 -5.64 0 0 4.8 +1Score > 19 indicates identity YQDHMINTLADAR + Deamidated (NQ); Oxidation (M)
2681 589.7679 1177.5213 1177.5332 -10.1 1 0 4.3 +1Score > 19 indicates identity ANNPTSRMMR + Deamidated (NQ)
3030 616.7802 2463.0917 2463.0656 10.6 0 0 3.6 +1Score > 18 indicates identity MSSGGAANGSYHSNGLGGHIETGMR + Oxidation (M)
447 414.1881 1652.7235 1652.7253 -1.09 0 0 4.7 +1Score > 19 indicates identity CWQEEAYAEAQLR
2476 576.2618 2301.0183 2301.0140 1.85 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 RVINSFNSELMGEMSNNNIK + 5 Deamidated (NQ)
4482 738.3355 2949.3129 2949.3499 -12.5 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 MNNAFMMHASTSPFYPLFAALNINAK + Deamidated (NQ); 3 Oxidation (M)
4944 778.8539 3111.3864 3111.3978 -3.66 1 0 3.9 +1Score > 18 indicates identity SWGMPDQAKLSQAQAEQLEQAYQAATGGK + 4 Deamidated (NQ); Oxidation (M)
6530 900.4092 2698.2057 2698.2189 -4.90 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 QRLHDGEIVSFGLDPYCMMLER + Deamidated (NQ); 2 Oxidation (M)
1429 495.2250 1482.6531 1482.6820 -19.5 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 GYDRAMGARPMAR + 2 Oxidation (M)
1523 495.2250 1976.8708 1976.8828 -6.08 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 GCMGVDIGSAMTYMLLAR + 2 Oxidation (M)
2826 603.2741 1806.8005 1806.8314 -17.1 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 TVAAEMPAMQCLQLAR + 2 Deamidated (NQ); Oxidation (M)
3326 643.7925 2571.1411 2571.1655 -9.50 1 0 3.9 +1Score > 18 indicates identity MTANLQPGEYDMTCGLLTNPKGK + Deamidated (NQ); 2 Oxidation (M)
3769 684.3109 2049.9109 2049.9500 -19.0 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 QDAVQHAQQLLKMMGYGV + 2 Deamidated (NQ); 2 Oxidation (M)
4479 738.3355 2949.3129 2949.3516 -13.1 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 AGDIAPKFSLPDQDGEQVNLTDFQGQR + 4 Deamidated (NQ)
5032 778.8539 1555.6932 1555.6646 18.4 0 0 3.9 +1Score > 18 indicates identity MAAEEFTQAMNGVR + 2 Deamidated (NQ)
6035 859.8907 3435.5339 3435.5790 -13.1 1 0 3.8 +1Score > 18 indicates identity YGRGPVGGNYYAGTSSISANVPFGAQTMATPDGR + Deamidated (NQ); Oxidation (M)
6240 873.3969 3489.5585 3489.6093 -14.6 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 TTTTASMQINLNSSDPLPTVTPFSASNADSYNK + Deamidated (NQ); Oxidation (M)
1 387.1759 772.3372
2 387.1759 772.3372
3 387.1759 772.3372
4 387.1759 772.3372
5 387.1759 772.3372
6 387.1759 772.3372
7 387.1759 772.3372
8 387.1759 772.3372
9 387.1759 772.3372
10 387.1759 772.3372
11 387.1759 772.3372
12 387.1759 772.3372
13 387.1759 772.3372
14 387.1759 772.3372
15 387.1759 772.3372
16 387.1759 772.3372
17 387.1759 772.3372
18 387.1759 772.3372
19 387.1759 772.3372
20 387.1759 772.3372
24 387.1759 772.3372
25 387.1759 772.3372
27 387.1759 772.3372
28 387.1759 772.3372
29 387.1759 772.3372
30 387.1759 772.3372
32 387.1759 772.3372
34 387.1759 772.3372
35 387.1759 772.3372
37 387.1759 772.3372
38 387.1759 772.3372
39 387.1759 772.3372
41 387.1759 772.3372
42 387.1759 772.3372
44 387.1759 772.3372
45 387.1759 772.3372
46 387.1759 772.3372
50 387.1759 772.3372
53 387.1759 772.3372
54 387.1759 772.3372
57 387.1759 772.3372
61 387.1759 772.3372
63 387.1759 772.3372
68 387.1759 772.3372
69 387.1759 772.3372
71 387.1759 772.3372
72 387.1759 772.3372
75 387.1759 772.3372
76 387.1759 772.3372
81 387.1759 772.3372
84 387.1759 772.3372
88 387.1759 772.3372
90 387.1759 772.3372
92 387.1759 772.3372
95 387.1759 772.3372
97 387.1759 772.3372
98 387.1759 772.3372
99 387.1759 772.3372
100 387.1759 772.3372
101 387.1759 772.3372
103 387.1759 772.3372
104 387.1759 772.3372
105 387.1759 772.3372
106 387.1759 772.3372
107 387.1759 772.3372
109 387.1759 772.3372
110 387.1759 772.3372
112 387.1759 772.3372
114 387.1759 772.3372
115 387.1759 772.3372
117 387.1759 772.3372
125 387.1759 772.3372
134 387.1759 772.3372
137 387.1759 772.3372
138 387.1759 772.3372
142 387.1759 772.3372
143 387.1759 772.3372
Page: Previous 1 …15 16 17 18 19 20 21 22 23 24 25 … 76 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/