MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 4 Dec 2025 at 15:28:39 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1801–1900 (out of 7566)


Page: Previous 1 14 15 16 17 18 19 20 21 22 23 24  76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2111 549.2496 2192.9692 2193.0017 -14.8 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
IAFVCDAGMGSSAMGATTFRK + Oxidation (M)
2417 576.2618 1150.5091 1150.5214 -10.7 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
NTTEAGATSGSR
2638 589.7679 2355.0427 2355.0855 -18.2 1 0 4.1 +1Score > 19 indicates identity MPGNSPHYGRWPQHDFTSLK + Deamidated (NQ)
5055 778.8539 1555.6932 1555.7188 -16.4 1 0 3.7 +1Score > 18 indicates identity YDKELTENEMIR + Oxidation (M)
5532 819.3723 2455.0951 2455.1399 -18.3 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
IPTWIMQGYATLADEAVEQMR + Deamidated (NQ); 2 Oxidation (M)
5567 819.3723 1636.7301 1636.7303 -0.17 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
WQNMNENRTLWK + 2 Deamidated (NQ); Oxidation (M)
329 400.6820 1598.6989 1598.7186 -12.3 1 0 2.1 +1Score > 16 indicates identity GGQHSGGNFKNDPQR + Deamidated (NQ)
2593 589.7679 2355.0427 2355.0695 -11.4 0 0 4.1 +1Score > 19 indicates identity IQVWLNDWNNDFFNALSQK + 4 Deamidated (NQ)
2683 589.7679 2355.0427 2355.0206 9.38 1 0 4.1 +1Score > 19 indicates identity AMMDNLQTETVINRDGQEEK + 2 Deamidated (NQ); 2 Oxidation (M)
5661 832.8785 3327.4848 3327.4482 11.0 1 0 4.5 +1Score > 19 indicates identity EQDKLWCGISDGAIDVVATDHCTFSMAQR + 2 Deamidated (NQ); Oxidation (M)
6709 913.9153 3651.6320 3651.5783 14.7 1 0 4.3 +1Score > 19 indicates identity AGDNGVTGGYSQFFGLKHQMSFDNGMNWNNALR + 3 Deamidated (NQ); Oxidation (M)
7553 980.1954 2937.5645 2937.5382 8.94 1 0 3.6 +1Score > 18 indicates identity IAAWLTPDTIPGLDTLDLMQAQQVRR + Oxidation (M)
2276 562.7557 2246.9936 2246.9823 5.01 1 0 3.6 +1Score > 18 indicates identity GITNSQAEWMKYGEQMSTGK + 2 Deamidated (NQ)
4474 738.3355 2211.9847 2212.0140 -13.2 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
MGRTQLQDAVPMTLGQEFR + 3 Deamidated (NQ); 2 Oxidation (M)
5704 832.8785 3327.4848 3327.5452 -18.2 1 0 4.5 +1Score > 19 indicates identity IQTWQYSDSQQAISIEDNGCGIDLSLQKK + 3 Deamidated (NQ)
5951 859.8907 3435.5339 3435.5929 -17.2 1 0 3.6 +1Score > 18 indicates identity RQMLNEHYDVTTAAYAVGYESYPISVGNIR + 3 Deamidated (NQ); Oxidation (M)
7186 954.4337 2860.2793 2860.3072 -9.76 1 0 0.98 +1Score > 21 indicates identity
Score > 13 indicates homology
AYSTDSNMLGATHEAKDLEYLNSSVK + Deamidated (NQ); Oxidation (M)
7497 980.1954 2937.5645 2937.5250 13.5 1 0 3.6 +1Score > 18 indicates identity YQTPHHRLQSGIDAVLHVLDWVPVR + 2 Deamidated (NQ)
3006 616.7802 2463.0917 2463.0673 9.93 1 0 3.5 +1Score > 18 indicates identity QQEAQSWQQRQNELTALQNR + 8 Deamidated (NQ)
3955 697.8171 1393.6196 1393.6296 -7.17 1 0 4.6 +1Score > 19 indicates identity LNFDPNGKMSDR + Deamidated (NQ)
5284 805.8662 3219.4357 3219.4666 -9.58 1 0 3.8 +1Score > 19 indicates identity TNVDLQIRIMNDENFQHGGTNIHYLEK + 5 Deamidated (NQ); Oxidation (M)
5792 846.3846 3381.5092 3381.4884 6.15 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
MDTPRPQLLDFQFHQNNDSFTLHFQQR + 6 Deamidated (NQ); Oxidation (M)
6478 900.4092 3597.6076 3597.6584 -14.1 0 0 0.99 +1Score > 20 indicates identity
Score > 13 indicates homology
VADIWTWYANHQSLCNPLYNLMYQAGVPLR + 5 Deamidated (NQ)
7153 954.4337 3813.7058 3813.6848 5.50 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
LEAGMNLYGQEMDETISPLAANMGWTIAWEPADR + 2 Deamidated (NQ); 2 Oxidation (M)
731 441.2004 1320.5795 1320.5988 -14.6 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
LCEMAPEMRGK
1752 522.2372 2084.9199 2084.9143 2.69 1 0 4.6 +1Score > 19 indicates identity EAGINNCYLEGEMVQGKR + 2 Deamidated (NQ); Oxidation (M)
1973 535.7434 2138.9445 2138.9572 -5.92 1 0 3.1 +1Score > 18 indicates identity SMNDALITRVTGEENGQMR + 2 Deamidated (NQ); Oxidation (M)
5698 832.8785 3327.4848 3327.5071 -6.69 1 0 4.5 +1Score > 19 indicates identity NCATQFISCQDSVAALGMRVLGNPYGNDPR + Deamidated (NQ); Oxidation (M)
7152 954.4337 1906.8529 1906.8513 0.82 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
DDVNEVRNGMECGIGVK + Oxidation (M)
2910 616.7802 1231.5459 1231.5503 -3.59 0 0 3.5 +1Score > 18 indicates identity IGMENGTTHQK + Deamidated (NQ); Oxidation (M)
3887 684.3109 2733.2145 2733.2399 -9.26 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
CQNSKLEAAVTQAEQQGEVALNDAR + 4 Deamidated (NQ)
5151 792.3600 2374.0583 2374.0342 10.1 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
SLADHQSAAANDIRQMIQDNR + 5 Deamidated (NQ); Oxidation (M)
5688 832.8785 3327.4848 3327.5143 -8.85 1 0 4.5 +1Score > 19 indicates identity SGGFVEGADEFDPAFFGISPREAVAMDPQQR + Deamidated (NQ)
6166 873.3969 3489.5585 3489.6279 -19.9 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
EGQHLMLEIEDNAGLYQPVTNASGLGMNLVDK + 2 Deamidated (NQ); 2 Oxidation (M)
157 387.1759 1158.5058 1158.5265 -17.9 1 0 2.4 +1Score > 16 indicates identity GDNLPDNTRR + 2 Deamidated (NQ)
89 387.1759 772.3372 772.3464 -11.9 0 0 2.4 +1Score > 16 indicates identity NNPDGTR
5523 819.3723 3273.4602 3273.5023 -12.9 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
QNLQQVMAIFSEWSNAATFEKLEVDAER + 4 Deamidated (NQ); Oxidation (M)
6282 886.9030 3543.5830 3543.5996 -4.70 0 0 4.5 +1Score > 19 indicates identity SLGSIMTGSAYPGLWNLTYTPGDMSSMAEAYTR + Oxidation (M)
1088 468.2127 1401.6163 1401.6062 7.22 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
WNQHGLGGDNFR + 2 Deamidated (NQ)
2148 549.2496 2192.9692 2193.0127 -19.8 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
WESGHHVHDNETELIYVK + Deamidated (NQ)
402 414.1881 1652.7235 1652.7253 -1.09 0 0 4.5 +1Score > 19 indicates identity CWQEEAYAEAQLR
830 441.2004 880.3863 880.3960 -11.0 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
AMTTDAQK + Oxidation (M)
913 454.7066 907.3986 907.4035 -5.44 0 0 3 +1Score > 17 indicates identity AQFEEER
2069 549.2496 2192.9692 2193.0017 -14.8 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
IAFVCDAGMGSSAMGATTFRK + Oxidation (M)
4283 724.8293 1447.6441 1447.6289 10.5 0 0 3.7 +1Score > 18 indicates identity MTYAVEFDNVSR + Deamidated (NQ); Oxidation (M)
6707 913.9153 1825.8160 1825.8485 -17.8 1 0 4.4 +1Score > 19 indicates identity MTGRLALVMGAEGEGMR + 3 Oxidation (M)
214 400.6820 1598.6989 1598.6824 10.4 0 0 2.2 +1Score > 16 indicates identity SEVEFSHEYWMR
1813 522.2372 2084.9199 2084.9361 -7.77 0 0 4.7 +1Score > 19 indicates identity SDNCEDTPEAGYFAIAVVK
2370 562.7557 1123.4968 1123.4889 7.01 0 0 3.6 +1Score > 18 indicates identity IMTQCVENK + 2 Deamidated (NQ)
6438 886.9030 1771.7915 1771.8265 -19.7 0 0 4.5 +1Score > 19 indicates identity TYDTNVEGSIVYGTPR + Deamidated (NQ)
7374 967.9399 3867.7304 3867.7421 -3.02 0 0 4.6 +1Score > 19 indicates identity SFGSMAGSNAAYELTSTYTPAGQLQSQHLNSLVYDR + 4 Deamidated (NQ)
564 427.6943 853.3741 853.3600 16.5 0 0 2.1 +1Score > 16 indicates identity MTSSAGQR + Deamidated (NQ); Oxidation (M)
708 441.2004 1760.7727 1760.7709 0.99 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
VAAQHSMMPAETESEK + Oxidation (M)
1395 495.2250 1482.6531 1482.6521 0.67 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
MNNNDLFQASRR + 2 Deamidated (NQ); Oxidation (M)
1569 508.7311 1015.4477 1015.4458 1.91 0 0 2.7 +1Score > 17 indicates identity GNNQPDIQK + 3 Deamidated (NQ)
2359 562.7557 2246.9936 2247.0212 -12.3 0 0 3.6 +1Score > 18 indicates identity QMAIDADLNAGLINQAQAQTR + 6 Deamidated (NQ)
3453 657.2986 2625.1655 2625.2050 -15.1 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
QAKGEFLMSDMLAVEQETNNDVR + Deamidated (NQ)
6462 900.4092 2698.2057 2698.2267 -7.79 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
QMYGLNAIEHSNYLRNYMGHLR + 3 Deamidated (NQ); Oxidation (M)
495 414.1881 1652.7235 1652.7253 -1.09 0 0 4.6 +1Score > 19 indicates identity CWQEEAYAEAQLR
2228 562.7557 1123.4968 1123.5179 -18.8 0 0 3.6 +1Score > 18 indicates identity SASLSDIEMR + Oxidation (M)
3271 643.7925 2571.1411 2571.1390 0.82 1 0 3.8 +1Score > 18 indicates identity MQTQMQTQQIQQKGMLNQQLK + 7 Deamidated (NQ); 2 Oxidation (M)
4224 711.3232 2130.9479 2130.9487 -0.38 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
NRLAESEASNDQAPVQMPR + 3 Deamidated (NQ); Oxidation (M)
5247 792.3600 2374.0583 2374.0470 4.75 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
AQMEQQFSANFFGAHQLTMR + Deamidated (NQ); 2 Oxidation (M)
6511 900.4092 3597.6076 3597.5592 13.5 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
DVEAVLSSDSYPFFLDAMYGDMPNNWSPELR + Deamidated (NQ); 2 Oxidation (M)
7218 954.4337 3813.7058 3813.6848 5.50 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
LEAGMNLYGQEMDETISPLAANMGWTIAWEPADR + 2 Deamidated (NQ); 2 Oxidation (M)
634 427.6943 1706.7481 1706.7788 -18.0 0 0 2.1 +1Score > 16 indicates identity AENFHEITEDDIFK
3764 684.3109 2049.9109 2049.8958 7.39 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
AGACYMPMSYKAAESEIR + Oxidation (M)
3988 697.8171 1393.6196 1393.6217 -1.53 0 0 4.7 +1Score > 19 indicates identity SMQDPIADMLTR + Deamidated (NQ); Oxidation (M)
6923 927.4214 1852.8283 1852.8546 -14.2 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
MSKSIGNTVSPQDVMNK + 2 Deamidated (NQ); Oxidation (M)
924 454.7066 1814.7972 1814.8145 -9.56 0 0 3.1 +1Score > 17 indicates identity TEGATVFGYQVMDPER + Oxidation (M)
2607 589.7679 2355.0427 2355.0873 -18.9 1 0 4.3 +1Score > 19 indicates identity SLADHQSAAANDIRQMIQDNR + 2 Deamidated (NQ)
4316 724.8293 1447.6441 1447.6467 -1.74 0 0 3.7 +1Score > 18 indicates identity SNVQEWQQLANK + 4 Deamidated (NQ)
1356 481.7188 1922.8463 1922.8778 -16.4 0 0 3.4 +1Score > 18 indicates identity SANMTLEQLESLNAEQK + 2 Deamidated (NQ); Oxidation (M)
1522 495.2250 988.4354 988.4461 -10.9 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
VNADPESTR + Deamidated (NQ)
2695 589.7679 2355.0427 2355.0695 -11.4 0 0 4.3 +1Score > 19 indicates identity IQVWLNDWNNDFFNALSQK + 4 Deamidated (NQ)
4558 738.3355 2211.9847 2211.9881 -1.55 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
TSYSEFLSQLANQYASCLK + 3 Deamidated (NQ)
6161 873.3969 3489.5585 3489.5641 -1.58 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
NIAMVFQNYALYPHMTVYDNMAFGLKMQK + 4 Deamidated (NQ); 3 Oxidation (M)
6837 927.4214 1852.8283 1852.8248 1.92 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
LMDDTIAQVQTSGEAEK + 2 Deamidated (NQ); Oxidation (M)
2122 549.2496 2192.9692 2192.9896 -9.29 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
EAVLCEWTETVNTPSAQTR + 2 Deamidated (NQ)
3865 684.3109 2733.2145 2733.2567 -15.4 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
FTGGSVQVFHGMAAYFGLPEALMNR + 2 Deamidated (NQ); 2 Oxidation (M)
3968 697.8171 2787.2392 2787.2520 -4.59 0 0 4.7 +1Score > 19 indicates identity AGIPLDVMYDVVTNAAGNSWMFENR + 2 Deamidated (NQ); Oxidation (M)
4314 724.8293 2895.2883 2895.3385 -17.3 0 0 3.7 +1Score > 18 indicates identity QAYGQALAMYHGQTYQIAPEQPLGDK + 2 Deamidated (NQ); Oxidation (M)
6359 886.9030 3543.5830 3543.5996 -4.70 0 0 4.6 +1Score > 19 indicates identity SLGSIMTGSAYPGLWNLTYTPGDMSSMAEAYTR + Oxidation (M)
154 387.1759 1544.6744 1544.6817 -4.72 0 0 2.4 +1Score > 16 indicates identity FEGCLEYETQLR + Deamidated (NQ)
2275 562.7557 2246.9936 2246.9898 1.70 0 0 3.7 +1Score > 18 indicates identity NDGYLMFQQVPMVEIDGMK + Deamidated (NQ); 2 Oxidation (M)
2797 603.2741 2409.0673 2409.0689 -0.64 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
HSTNAVQIMGALGCNDNYSISR + 2 Deamidated (NQ)
3260 643.7925 1285.5705 1285.5496 16.3 0 0 3.9 +1Score > 18 indicates identity NGSYLVEMDNK + Deamidated (NQ); Oxidation (M)
7055 940.9276 3759.6811 3759.7542 -19.4 0 0 4.6 +1Score > 19 indicates identity AAAEMAESVTNPQRPPVIWIGAQECTGCTESLLR + 2 Deamidated (NQ); Oxidation (M)
801 441.2004 1760.7727 1760.7974 -14.1 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
YSMAVMQRHIEHDK + Deamidated (NQ); Oxidation (M)
1753 522.2372 2084.9199 2084.9176 1.07 1 0 4.8 +1Score > 19 indicates identity MTTLNCSGQCRLQAVEAK + 3 Deamidated (NQ); Oxidation (M)
3320 643.7925 2571.1411 2571.1655 -9.51 0 0 3.9 +1Score > 18 indicates identity LISMMDGDISVDSEPGMGSQFTVR
5819 846.3846 1690.7546 1690.7879 -19.7 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
RIAAGCGMQVQDVNR + Deamidated (NQ); Oxidation (M)
7047 940.9276 1879.8406 1879.8410 -0.26 1 0 4.6 +1Score > 19 indicates identity NSKDIINCFESSFYR + Deamidated (NQ)
7559 980.1954 2937.5645 2937.6190 -18.6 1 0 3.7 +1Score > 18 indicates identity MNSLQILSFVGFTLLVAVITWWKVR + Deamidated (NQ); Oxidation (M)
1738 522.2372 2084.9199 2084.9426 -10.9 0 0 4.8 +1Score > 19 indicates identity FTNEDLEALQSLQNGFQK + 4 Deamidated (NQ)
4894 765.3478 3057.3620 3057.3146 15.5 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
QIYMSNSTTFDDQGFASNNTGLSGTVGSR + 3 Deamidated (NQ)
5106 792.3600 3165.4111 3165.4430 -10.1 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
MNCAAMPAGLLESDLFGHERGAFTGASAQR + Deamidated (NQ)
5109 792.3600 2374.0583 2374.0482 4.27 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
QENISVTDSYSTGNAAQAMLEK + 2 Deamidated (NQ); Oxidation (M)
5964 859.8907 1717.7669 1717.7808 -8.09 1 0 3.8 +1Score > 18 indicates identity GHSFEFRINGEDPGR + Deamidated (NQ)
7060 940.9276 3759.6811 3759.7356 -14.5 1 0 4.6 +1Score > 19 indicates identity GASTWAGGQSQDELMLKDECILVDADDNITGHVSK
Page: Previous 1 14 15 16 17 18 19 20 21 22 23 24  76 Next 

Not what you expected? Try the select summary.