MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 4 Dec 2025 at 15:28:39 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1701–1800 (out of 7566)


Page: Previous 1 13 14 15 16 17 18 19 20 21 22 23  76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
726 441.2004 1760.7727 1760.7426 17.1 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
VTMPMFNAFWQQNK + 4 Deamidated (NQ); Oxidation (M)
805 441.2004 1760.7727 1760.7424 17.2 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
EDYAYSQQMQRDAR + Deamidated (NQ)
3828 684.3109 2733.2145 2733.2577 -15.8 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
NQGTAQNIQLELQDDSGNTLNTGATK + 3 Deamidated (NQ)
5508 819.3723 3273.4602 3273.5036 -13.3 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
ACTQAAEVALFTYNSRAAQIWWQQNQSK + 4 Deamidated (NQ)
3645 670.8048 1339.5951 1339.5788 12.2 0 0 4.2 +1Score > 19 indicates identity NMWILMEENK + Deamidated (NQ); 2 Oxidation (M)
4816 765.3478 2293.0215 2293.0468 -11.0 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
TFTDMQQVDHDALVQAMVGR + 2 Oxidation (M)
673 427.6943 1706.7481 1706.7756 -16.1 1 0 1.9 +1Score > 16 indicates identity EEVVGAEMMRHFEK + Oxidation (M)
2441 576.2618 2301.0183 2300.9898 12.4 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
NPPEISFGEKMMISGSMCNR + Deamidated (NQ); Oxidation (M)
2926 616.7802 2463.0917 2463.1237 -13.0 1 0 3.3 +1Score > 18 indicates identity AWLYQGDHCLESRQSEAGVTR + Deamidated (NQ)
3803 684.3109 2049.9109 2049.9282 -8.42 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
AMVIAPCSRMGPVTEDER + 2 Oxidation (M)
3807 684.3109 1366.6073 1366.5922 11.0 1 0 0.92 +1Score > 20 indicates identity
Score > 13 indicates homology
QGLDSDAEKEMK + Deamidated (NQ); Oxidation (M)
4595 751.8416 3003.3374 3003.3808 -14.5 0 0 3.9 +1Score > 19 indicates identity AQMINSYDNSVTYVDHFISSVIDQVR + 3 Deamidated (NQ)
5473 819.3723 3273.4602 3273.5169 -17.3 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
MDAFIQYGIVAGVQAMQDSGLEITEENATR + Deamidated (NQ); Oxidation (M)
6403 886.9030 3543.5830 3543.6304 -13.4 0 0 4.2 +1Score > 19 indicates identity GSVELVEIPTNDETNDNIVAYWTPDQLPEPGK + 4 Deamidated (NQ)
7204 954.4337 2860.2793 2860.2639 5.40 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
TSLHFAMMQAQNNVLMMTGVSPSIGK + 4 Deamidated (NQ); 4 Oxidation (M)
116 387.1759 1158.5058 1158.5202 -12.4 0 0 2.2 +1Score > 16 indicates identity CFAFMQAVGK + Deamidated (NQ)
1162 468.2127 1868.8217 1868.8356 -7.44 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
MSANTEAQGSGRGLEAMK + 2 Oxidation (M)
2358 562.7557 2246.9936 2246.9498 19.5 1 0 3.4 +1Score > 18 indicates identity SANDAQSGPGTWNPAMRQAER + 4 Deamidated (NQ)
3179 630.2864 2517.1164 2517.1251 -3.44 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
SLPMLQVALDNQTMDSAYETTR + 2 Deamidated (NQ); 2 Oxidation (M)
4004 697.8171 1393.6196 1393.6143 3.77 0 0 4.3 +1Score > 19 indicates identity GGAMQNLGQDSATK + Deamidated (NQ); Oxidation (M)
4932 778.8539 1555.6932 1555.6759 11.1 0 0 3.5 +1Score > 18 indicates identity QQVEGASAMGQMFR + Deamidated (NQ); Oxidation (M)
7493 980.1954 3916.7526 3916.8286 -19.4 1 0 3.4 +1Score > 18 indicates identity QLEQENAELESRIQEASHSQVLTMTPDYQSHFR + Oxidation (M)
1892 535.7434 2138.9445 2138.9650 -9.58 1 0 3 +1Score > 18 indicates identity NMSEAERQNYLATEEAQR
4862 765.3478 3057.3620 3057.3637 -0.54 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
YVTQEELRQMMQPDNGLQWSPWFR + 3 Deamidated (NQ); Oxidation (M)
530 427.6943 1706.7481 1706.7790 -18.1 0 0 2 +1Score > 16 indicates identity HCQETGLSLSGLMMK + Oxidation (M)
3377 643.7925 2571.1411 2571.1880 -18.2 1 0 3.6 +1Score > 18 indicates identity HDSSVTGIMMSLCSERFVSSLGR + Oxidation (M)
5618 832.8785 3327.4848 3327.5322 -14.2 1 0 4.3 +1Score > 19 indicates identity GVNRHEHHPLHGQVMDEQTMVQDILLMK + 4 Deamidated (NQ); 2 Oxidation (M)
1005 454.7066 1814.7972 1814.8100 -7.07 0 0 2.9 +1Score > 17 indicates identity VMQVSAMADQMLLDSK + Deamidated (NQ); 3 Oxidation (M)
1119 468.2127 1401.6163 1401.6419 -18.3 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
MQTNPQNQQRR + 2 Deamidated (NQ)
2782 603.2741 2409.0673 2409.1086 -17.1 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
AGTMSGGEQQMLAIGRALMSNPR + 2 Deamidated (NQ); 2 Oxidation (M)
4624 751.8416 3003.3374 3003.3704 -11.0 0 0 4 +1Score > 19 indicates identity LSHTCFQVLAYEPYLELCEIMNQK + 2 Deamidated (NQ); Oxidation (M)
5423 805.8662 3219.4357 3219.4917 -17.4 1 0 3.6 +1Score > 19 indicates identity SALQYKVHYDTTLNGGFATAMALNADATEK + 3 Deamidated (NQ); Oxidation (M)
6802 927.4214 3705.6567 3705.7232 -18.0 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
SVVSGATPVMRDSEHFFFDLPSFSEMLQAWTR + 2 Oxidation (M)
4128 711.3232 2841.2639 2841.3027 -13.7 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
MAGLPNSSNALQQWHHLFEAEGTKR + 4 Deamidated (NQ); Oxidation (M)
442 414.1881 1652.7235 1652.7318 -5.03 1 0 4.3 +1Score > 19 indicates identity WYAERDAEIENEK + Deamidated (NQ)
1720 522.2372 1042.4599 1042.4576 2.26 0 0 4.4 +1Score > 19 indicates identity GFADAIMMR + 2 Oxidation (M)
6849 927.4214 3705.6567 3705.7232 -18.0 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
SVVSGATPVMRDSEHFFFDLPSFSEMLQAWTR + 2 Oxidation (M)
7161 954.4337 2860.2793 2860.3126 -11.6 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
LTFDGDHLATIVNMENNRQFGFFR + 3 Deamidated (NQ); Oxidation (M)
1130 468.2127 934.4109 934.4219 -11.8 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
TFPDCAPK
2105 549.2496 2192.9692 2192.9650 1.89 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
YSFKGNGWNNGVGVSAQYNK + 4 Deamidated (NQ)
2839 603.2741 1204.5337 1204.5571 -19.5 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
DNVTDKNELR + 2 Deamidated (NQ)
2845 603.2741 1806.8005 1806.8327 -17.8 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
WCREMLQNSPMALR + Oxidation (M)
4117 711.3232 2130.9479 2130.9780 -14.1 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
GMDQYAEQLYTDVVDLQK + Oxidation (M)
7135 954.4337 1906.8529 1906.8513 0.82 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
DDVNEVRNGMECGIGVK + Oxidation (M)
7183 954.4337 3813.7058 3813.7145 -2.29 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
NGTTVQQWVSQAGAQDCVLALENESNPHNLGGMMR + 2 Deamidated (NQ)
7190 954.4337 2860.2793 2860.3319 -18.4 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
YWFPDIAGSDWLETLHFAMRDFK + Oxidation (M)
7480 980.1954 2937.5645 2937.5497 5.05 1 0 3.4 +1Score > 18 indicates identity LLSGGWLPLSLGTVMFIVMTTWKSER + Oxidation (M)
7615 980.1954 2937.5645 2937.5382 8.94 1 0 3.4 +1Score > 18 indicates identity IAAWLTPDTIPGLDTLDLMQAQQVRR + Oxidation (M)
809 441.2004 1320.5795 1320.6020 -17.0 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
DGIPLMEEDFR
3524 657.2986 1968.8741 1968.8638 5.26 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
WDKGYDVLQYFEMMK + Deamidated (NQ); Oxidation (M)
3777 684.3109 2733.2145 2733.2577 -15.8 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
NQGTAQNIQLELQDDSGNTLNTGATK + 3 Deamidated (NQ)
6705 913.9153 1825.8160 1825.8372 -11.6 0 0 4.2 +1Score > 19 indicates identity AMLTLMLQAMGQADAGR + Deamidated (NQ); 3 Oxidation (M)
6708 913.9153 3651.6320 3651.6458 -3.76 0 0 4.2 +1Score > 19 indicates identity NATVETTQHDVEGTGAAGATAMLFPGMGPAAFSDVGR + 2 Deamidated (NQ); Oxidation (M)
6931 927.4214 3705.6567 3705.6828 -7.05 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
EDGCVVDMHHFNSGAQSVLAYATVNGSLVGWDLR + 2 Deamidated (NQ)
1491 495.2250 1976.8708 1976.9075 -18.6 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
FNQPEQAARTLSGGNQQK + 4 Deamidated (NQ)
3698 670.8048 2679.1901 2679.1880 0.81 0 0 4.3 +1Score > 19 indicates identity YVTGGNNQWHTVASLHMTIMMNR + 3 Deamidated (NQ); Oxidation (M)
5787 846.3846 2536.1319 2536.1322 -0.10 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
AASMITESQCYQLEQNLHQQR + 2 Deamidated (NQ)
3255 643.7925 1285.5705 1285.5795 -6.95 0 0 3.7 +1Score > 18 indicates identity MVTNLYQNMR + Deamidated (NQ); Oxidation (M)
5452 819.3723 2455.0951 2455.0843 4.42 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
DGSVTAGNASGINDGAAAVLMMSADK + Deamidated (NQ); 2 Oxidation (M)
5610 832.8785 3327.4848 3327.5448 -18.0 1 0 4.3 +1Score > 19 indicates identity HFEKNGVFFCFGWETTQSVTVNFNLYR + Deamidated (NQ)
7162 954.4337 2860.2793 2860.3133 -11.9 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
YSNFKDFWEQLKPGYDYFEQTR
638 427.6943 1706.7481 1706.7675 -11.4 0 0 2 +1Score > 16 indicates identity DNLTGSEQIFYSGFK + 2 Deamidated (NQ)
1059 468.2127 1401.6163 1401.6235 -5.11 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
NGGVKQFFMNDK + 2 Deamidated (NQ); Oxidation (M)
2518 576.2618 1150.5091 1150.5223 -11.4 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
RGMMGEALNR + Deamidated (NQ); Oxidation (M)
3357 643.7925 2571.1411 2571.1759 -13.5 0 0 3.7 +1Score > 18 indicates identity NNVTTDAGAGFEQTLTGMTVGIDSR + Deamidated (NQ); Oxidation (M)
4121 711.3232 2841.2639 2841.3027 -13.7 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
MAGLPNSSNALQQWHHLFEAEGTKR + 4 Deamidated (NQ); Oxidation (M)
6799 927.4214 2779.2425 2779.2970 -19.6 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
GDTMQQRLTQDLTQFLASLPEDDR + 2 Deamidated (NQ)
270 400.6820 1598.6989 1598.7186 -12.3 1 0 2.1 +1Score > 16 indicates identity GGQHSGGNFKNDPQR + Deamidated (NQ)
1742 522.2372 1563.6899 1563.6987 -5.64 0 0 4.5 +1Score > 19 indicates identity YQDHMINTLADAR + Deamidated (NQ); Oxidation (M)
7149 954.4337 3813.7058 3813.7403 -9.06 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
QLFLMAFHQSHTSFSVANAPDEPHIEQLVGECR + 3 Deamidated (NQ); Oxidation (M)
1159 468.2127 934.4109 934.4144 -3.82 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
NYGAAQPGR + 2 Deamidated (NQ)
1548 508.7311 2030.8955 2030.9037 -4.05 1 0 2.6 +1Score > 17 indicates identity HGNSEMQKINQTSAMPEK + 2 Deamidated (NQ)
1863 522.2372 1563.6899 1563.6987 -5.64 0 0 4.5 +1Score > 19 indicates identity YVHQLDNNASVMR + 2 Deamidated (NQ); Oxidation (M)
2680 589.7679 2355.0427 2355.0796 -15.7 1 0 4.1 +1Score > 19 indicates identity NFVLMQQKMAAGENPAAEMIK + 3 Deamidated (NQ); 2 Oxidation (M)
1971 535.7434 2138.9445 2138.9830 -18.0 0 0 3 +1Score > 18 indicates identity LAQWIEDNVTFPSTMVDR + 2 Deamidated (NQ); Oxidation (M)
2503 576.2618 1150.5091 1150.5111 -1.69 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
LMGMTPTGNGR + Deamidated (NQ); Oxidation (M)
6148 873.3969 3489.5585 3489.5641 -1.58 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
NIAMVFQNYALYPHMTVYDNMAFGLKMQK + 4 Deamidated (NQ); 3 Oxidation (M)
326 400.6820 1598.6989 1598.7147 -9.89 0 0 2.1 +1Score > 16 indicates identity AMVGGSEPQFAGYNR + Oxidation (M)
536 427.6943 1706.7481 1706.7756 -16.1 1 0 2 +1Score > 16 indicates identity EEVVGAEMMRHFEK + Oxidation (M)
1721 522.2372 2084.9199 2084.9217 -0.87 0 0 4.5 +1Score > 19 indicates identity MWMAGQGTIQISDQMNIK + 2 Deamidated (NQ); 2 Oxidation (M)
7165 954.4337 3813.7058 3813.6848 5.50 0 0 0.99 +1Score > 21 indicates identity
Score > 13 indicates homology
LEAGMNLYGQEMDETISPLAANMGWTIAWEPADR + 2 Deamidated (NQ); 2 Oxidation (M)
7298 967.9399 3867.7304 3867.7760 -11.8 0 0 4.4 +1Score > 19 indicates identity WVDSITEAWAMDNDAPKPYQAGTWGPVASVAMITR + 2 Deamidated (NQ); 2 Oxidation (M)
7377 967.9399 3867.7304 3867.7421 -3.02 0 0 4.4 +1Score > 19 indicates identity SFGSMAGSNAAYELTSTYTPAGQLQSQHLNSLVYDR + 4 Deamidated (NQ)
368 414.1881 1652.7235 1652.7069 10.0 1 0 4.4 +1Score > 19 indicates identity RMGELMAESHASMR + 3 Oxidation (M)
1849 522.2372 2084.9199 2084.9355 -7.47 1 0 4.5 +1Score > 19 indicates identity MTSVGSQDTTGPMTRDELK + 2 Oxidation (M)
4780 765.3478 3057.3620 3057.3055 18.5 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
QMRGPIPEGMWGYDATAMQYNHDETK + 2 Oxidation (M)
4926 778.8539 1555.6932 1555.7154 -14.3 0 0 3.7 +1Score > 18 indicates identity ALQQYTADQFNAGK + 2 Deamidated (NQ)
7137 954.4337 2860.2793 2860.2466 11.4 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
YMGNNGPMQLEVPRDQYAGAVETMR + 2 Deamidated (NQ); 2 Oxidation (M)
1214 481.7188 1922.8463 1922.8778 -16.4 0 0 3.3 +1Score > 18 indicates identity SANMTLEQLESLNAEQK + 2 Deamidated (NQ); Oxidation (M)
3306 643.7925 2571.1411 2571.1911 -19.5 1 0 3.7 +1Score > 18 indicates identity HQLMVEQLDNETWDAAADTVRK + 2 Deamidated (NQ)
5194 792.3600 2374.0583 2374.0425 6.65 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
IGDAMEQMMEGLNKVMHGEPR + 2 Deamidated (NQ)
5844 846.3846 1690.7546 1690.7832 -16.9 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
TADQGTNIQTPAQMAK + Deamidated (NQ); Oxidation (M)
6760 913.9153 1825.8160 1825.8305 -7.91 1 0 4.3 +1Score > 19 indicates identity FYDENKNPMPSELSR
468 414.1881 826.3617 826.3643 -3.15 1 0 4.4 +1Score > 19 indicates identity RDDMFK + Oxidation (M)
538 427.6943 853.3741 853.3600 16.5 0 0 2 +1Score > 16 indicates identity MTSSAGQR + Deamidated (NQ); Oxidation (M)
5662 832.8785 3327.4848 3327.4482 11.0 1 0 4.4 +1Score > 19 indicates identity EQDKLWCGISDGAIDVVATDHCTFSMAQR + 2 Deamidated (NQ); Oxidation (M)
6627 913.9153 3651.6320 3651.5783 14.7 1 0 4.3 +1Score > 19 indicates identity AGDNGVTGGYSQFFGLKHQMSFDNGMNWNNALR + 3 Deamidated (NQ); Oxidation (M)
1157 468.2127 934.4109 934.4243 -14.4 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
TLSGGNQQK + 3 Deamidated (NQ)
1254 481.7188 1922.8463 1922.8601 -7.20 0 0 3.3 +1Score > 18 indicates identity ATIDGLENMNSPEMVAAK + Deamidated (NQ); 2 Oxidation (M)
1576 508.7311 2030.8955 2030.8646 15.2 0 0 2.6 +1Score > 17 indicates identity EGYHQDWNTLIYNYGR + 3 Deamidated (NQ)
Page: Previous 1 13 14 15 16 17 18 19 20 21 22 23  76 Next 

Not what you expected? Try the select summary.