MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 4 Dec 2025 at 15:28:39 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1601–1700 (out of 7566)


Page: Previous 1 12 13 14 15 16 17 18 19 20 21 22  76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
701 441.2004 1760.7727 1760.7709 0.99 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
VAAQHSMMPAETESEK + Oxidation (M)
3469 657.2986 2625.1655 2625.2050 -15.1 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
QAKGEFLMSDMLAVEQETNNDVR + Deamidated (NQ)
4594 751.8416 1501.6687 1501.6909 -14.8 1 1 3.7 +1Score > 19 indicates identity QNRSGAEHFGLQR + 3 Deamidated (NQ)
4800 765.3478 2293.0215 2293.0638 -18.4 0 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
DFFLDVELENQISENTLHK + 3 Deamidated (NQ)
4819 765.3478 1528.6810 1528.6645 10.8 0 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
MQEALMSLMQMAK + 2 Deamidated (NQ); Oxidation (M)
5273 805.8662 3219.4357 3219.4765 -12.7 0 1 3.4 +1Score > 19 indicates identity NADALIVEADVSTSDTPFANLPACEALEER + 2 Deamidated (NQ)
2003 535.7434 2138.9445 2138.9392 2.49 1 1 2.8 +1Score > 18 indicates identity LSEKNNNWTFNLANDDNK + 3 Deamidated (NQ)
5655 832.8785 3327.4848 3327.5322 -14.2 1 1 4 +1Score > 19 indicates identity GVNRHEHHPLHGQVMDEQTMVQDILLMK + 4 Deamidated (NQ); 2 Oxidation (M)
6818 927.4214 2779.2425 2779.2325 3.60 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
MMSECIYQEGNAFVIMGAGEQLKR + 2 Deamidated (NQ); Oxidation (M)
898 454.7066 1814.7972 1814.7853 6.53 0 1 2.7 +1Score > 17 indicates identity SHQHTTQTSGQGMLER + 2 Deamidated (NQ); Oxidation (M)
1958 535.7434 2138.9445 2138.9534 -4.13 1 1 2.8 +1Score > 18 indicates identity IDSMMNGQVKVQGMPDINK + 3 Deamidated (NQ); 2 Oxidation (M)
2324 562.7557 1123.4968 1123.5114 -13.0 0 1 3.2 +1Score > 18 indicates identity ISGTGMCNIR + Oxidation (M)
331 400.6820 1598.6989 1598.7246 -16.1 0 1 1.9 +1Score > 16 indicates identity SLVDNNMIYGDGSSK
2194 549.2496 1644.7269 1644.7267 0.13 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
WQQELNSPNEQIR + 4 Deamidated (NQ)
2524 576.2618 1725.7637 1725.7814 -10.3 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
EGMNIVEAMERFGSR + Deamidated (NQ)
3014 616.7802 1231.5459 1231.5503 -3.59 0 1 3.2 +1Score > 18 indicates identity IGMENGTTHQK + Deamidated (NQ); Oxidation (M)
3796 684.3109 2049.9109 2049.9500 -19.0 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
QDAVQHAQQLLKMMGYGV + 2 Deamidated (NQ); 2 Oxidation (M)
6158 873.3969 3489.5585 3489.5641 -1.58 1 1 0.91 +1Score > 22 indicates identity
Score > 13 indicates homology
NIAMVFQNYALYPHMTVYDNMAFGLKMQK + 4 Deamidated (NQ); 3 Oxidation (M)
6898 927.4214 2779.2425 2779.2577 -5.46 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
FSQTMMWIDTVNGLIMVDCASAKK + 2 Deamidated (NQ); 2 Oxidation (M)
1774 522.2372 2084.9199 2084.9469 -12.9 0 1 4.2 +1Score > 19 indicates identity MEMMPFLDSVGLVLDDNK + 2 Oxidation (M)
3352 643.7925 1285.5705 1285.5609 7.53 0 1 3.4 +1Score > 18 indicates identity DNGAEYTMTLR + Oxidation (M)
3456 657.2986 2625.1655 2625.2050 -15.1 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
QAKGEFLMSDMLAVEQETNNDVR + Deamidated (NQ)
3858 684.3109 1366.6073 1366.5922 11.0 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
QGLDSDAEKEMK + Deamidated (NQ); Oxidation (M)
6902 927.4214 1852.8283 1852.8407 -6.68 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
MSANTEAQGSGRGLEAMK + Oxidation (M)
269 400.6820 1598.6989 1598.7107 -7.36 1 1 2 +1Score > 16 indicates identity TGQICQSQRHRPQ + 4 Deamidated (NQ)
1797 522.2372 1563.6899 1563.6657 15.5 0 1 4.2 +1Score > 19 indicates identity MDSNNQIEPCLSR + Deamidated (NQ)
4360 724.8293 2895.2883 2895.2862 0.73 1 1 3.3 +1Score > 18 indicates identity AATLSDADAKAIANQGCAEMDSGNQVASK + 2 Deamidated (NQ)
4804 765.3478 2293.0215 2292.9845 16.1 0 1 0.93 +1Score > 21 indicates identity
Score > 13 indicates homology
LYSSDNMYPDSQQGFAPTVR + 2 Deamidated (NQ); Oxidation (M)
7361 967.9399 3867.7304 3867.6815 12.7 1 1 4.1 +1Score > 19 indicates identity KPDHDDGFACTTASMSEQNKVFEQAFFTMINQR + 2 Deamidated (NQ); Oxidation (M)
7487 980.1954 3916.7526 3916.7326 5.12 1 1 3.3 +1Score > 18 indicates identity QTEAYKLLFNFVNNQTGNINASEYFTGAINENER + 8 Deamidated (NQ)
3170 630.2864 2517.1164 2517.0722 17.5 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
NNYIHDLDMAAERMFTESGMR + Deamidated (NQ); Oxidation (M)
4833 765.3478 3057.3620 3057.3960 -11.1 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
EHIRQGMTLEVMVPQGHFGYQPQAER + 4 Deamidated (NQ); Oxidation (M)
5981 859.8907 3435.5339 3435.5898 -16.3 1 1 3.3 +1Score > 18 indicates identity SSEPIAIVGMSCRFPGGVDSPEGLWQMVADAR + Deamidated (NQ); Oxidation (M)
1204 481.7188 1922.8463 1922.8601 -7.20 0 1 3.1 +1Score > 18 indicates identity ATIDGLENMNSPEMVAAK + Deamidated (NQ); 2 Oxidation (M)
1760 522.2372 1563.6899 1563.6788 7.13 0 1 4.2 +1Score > 19 indicates identity QVDVATNNTENLDK + 4 Deamidated (NQ)
2108 549.2496 2192.9692 2192.9749 -2.63 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
FDYSEDSLSPAYNVTAAQSK + Deamidated (NQ)
4022 697.8171 2787.2392 2787.2408 -0.57 0 1 4.2 +1Score > 19 indicates identity GFMVLGFPCNQFLEQEPGSDEEIK + Deamidated (NQ); Oxidation (M)
5037 778.8539 1555.6932 1555.7017 -5.46 1 1 3.4 +1Score > 18 indicates identity DKIYDFFMNYGK + Oxidation (M)
1959 535.7434 2138.9445 2138.9716 -12.7 1 1 2.8 +1Score > 18 indicates identity ITGSQVKNNGYVQDTNNQR + 4 Deamidated (NQ)
3040 616.7802 2463.0917 2463.1046 -5.23 0 1 3.2 +1Score > 18 indicates identity ESGVTLSTFGVGNSNYNEAMMVR + Deamidated (NQ)
4444 738.3355 2211.9847 2211.9810 1.69 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
ALNTLEMMADMAEVDDSGKR + Oxidation (M)
6144 873.3969 1744.7793 1744.8115 -18.5 0 1 0.94 +1Score > 22 indicates identity
Score > 13 indicates homology
DNDQTANLGALIDAGVR + 3 Deamidated (NQ)
6500 900.4092 3597.6076 3597.5545 14.8 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
GSMAMAAVCGTSGIASLFSQAAFAADSDIADGQTQR + 3 Deamidated (NQ); 2 Oxidation (M)
1852 522.2372 1042.4599 1042.4753 -14.8 0 1 4.3 +1Score > 19 indicates identity GMAYITESR + Oxidation (M)
2061 549.2496 1644.7269 1644.7413 -8.78 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
STYEQQEMGKSVSR + Oxidation (M)
2244 562.7557 2246.9936 2246.9606 14.7 0 1 3.3 +1Score > 18 indicates identity HNIEAQHMTIDTNGQMVMK + 2 Deamidated (NQ); 3 Oxidation (M)
5042 778.8539 3111.3864 3111.4286 -13.6 1 1 3.4 +1Score > 18 indicates identity EMLCGVMEQTLPLPCSAPWFNRTGSSK + Oxidation (M)
6631 913.9153 1825.8160 1825.8438 -15.2 0 1 4 +1Score > 19 indicates identity LDDMLEIQTEITSMR + 2 Oxidation (M)
2847 603.2741 2409.0673 2409.1086 -17.1 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
AGTMSGGEQQMLAIGRALMSNPR + 2 Deamidated (NQ); 2 Oxidation (M)
3023 616.7802 2463.0917 2463.1053 -5.49 0 1 3.2 +1Score > 18 indicates identity MNIDTDTQWATWEGVLNYYK + Oxidation (M)
3185 630.2864 2517.1164 2517.1284 -4.77 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
IARQHPDNPVGQFCYWHFSR + 3 Deamidated (NQ)
5291 805.8662 3219.4357 3219.4487 -4.02 0 1 3.5 +1Score > 19 indicates identity NSFHVLDSQNNGVNANGTANGMSISLEAGQR + 2 Deamidated (NQ); Oxidation (M)
108 387.1759 1544.6744 1544.7048 -19.7 1 1 2.2 +1Score > 16 indicates identity KDAWYFANYDPR
2231 562.7557 2246.9936 2247.0008 -3.19 1 1 3.3 +1Score > 18 indicates identity NPARQQMLPNTNGGMLNSNR + 3 Deamidated (NQ); 2 Oxidation (M)
5276 805.8662 3219.4357 3219.4973 -19.1 1 1 3.5 +1Score > 19 indicates identity VAMMNRLQQALEHNHFFLMAQPITGMR + 4 Deamidated (NQ); 2 Oxidation (M)
5820 846.3846 3381.5092 3381.5713 -18.3 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
IGNMLLGGLVYPLTCQPQDMLQAMEENRR + 3 Deamidated (NQ); 2 Oxidation (M)
258 400.6820 1598.6989 1598.7001 -0.74 0 1 2 +1Score > 16 indicates identity FANSLFVNNWDNR + 3 Deamidated (NQ)
2786 603.2741 1806.8005 1806.7989 0.91 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
QQMLPNTNGGMLNSNR + Deamidated (NQ); 2 Oxidation (M)
2793 603.2741 1806.8005 1806.7989 0.91 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
QQMLPNTNGGMLNSNR + Deamidated (NQ); 2 Oxidation (M)
4025 697.8171 1393.6196 1393.6257 -4.41 0 1 4.2 +1Score > 19 indicates identity MAVMPEEELWK + 2 Oxidation (M)
548 427.6943 1706.7481 1706.7610 -7.56 0 1 1.9 +1Score > 16 indicates identity WDTLEDVWNGLCAK + Deamidated (NQ)
1617 508.7311 2030.8955 2030.9190 -11.6 1 1 2.4 +1Score > 17 indicates identity GRVYAVSMFNPQGNDMTK + Deamidated (NQ); Oxidation (M)
1870 522.2372 2084.9199 2084.9287 -4.22 0 1 4.3 +1Score > 19 indicates identity QTSLNGFYQDNGGDADLLR + 2 Deamidated (NQ)
612 427.6943 1706.7481 1706.7423 3.38 0 1 1.9 +1Score > 16 indicates identity SINEPEQFWAEQAR + 3 Deamidated (NQ)
5535 819.3723 3273.4602 3273.4334 8.16 0 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
DEPGTEISAGWGSNSYQNYDVSTQQQLGDK
5955 859.8907 3435.5339 3435.5898 -16.3 1 1 3.4 +1Score > 18 indicates identity SSEPIAIVGMSCRFPGGVDSPEGLWQMVADAR + Deamidated (NQ); Oxidation (M)
7246 954.4337 1906.8529 1906.8690 -8.46 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
LSAEDNARVNVAMNQTR + 3 Deamidated (NQ); Oxidation (M)
7427 967.9399 3867.7304 3867.7971 -17.2 0 1 4.2 +1Score > 19 indicates identity EEFMMLYLNQQNQLIAHETLFAGSISSTEVHPR + 3 Deamidated (NQ); 2 Oxidation (M)
7549 980.1954 3916.7526 3916.8290 -19.5 1 1 3.3 +1Score > 18 indicates identity QGGLVMQNYRLIDATLYVTLEPCVMCAGAMIHSR + 2 Deamidated (NQ); 3 Oxidation (M)
165 387.1759 1544.6744 1544.6889 -9.41 0 1 2.2 +1Score > 16 indicates identity QAGCTLHEVGTTNR + 2 Deamidated (NQ)
212 400.6820 799.3495 799.3460 4.28 0 1 2 +1Score > 16 indicates identity ATDDHNK
3890 684.3109 1366.6073 1366.6187 -8.36 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
MQPSRNFDDLK + Deamidated (NQ); Oxidation (M)
5799 846.3846 2536.1319 2536.1363 -1.71 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
QGMTLEVMVPQGHFGYQPQAER + 2 Deamidated (NQ); 2 Oxidation (M)
7035 940.9276 1879.8406 1879.8469 -3.40 0 1 4.2 +1Score > 19 indicates identity NEVVADGNDSVTMTATVR + 2 Deamidated (NQ)
3484 657.2986 1968.8741 1968.8499 12.3 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
CFADIQPMTDEFGWPR
4353 724.8293 2895.2883 2895.2778 3.61 1 0 3.4 +1Score > 18 indicates identity QPPMQQFIDNMMDASDHPKFAQYR + Deamidated (NQ)
6363 886.9030 3543.5830 3543.6075 -6.93 0 0 4.1 +1Score > 19 indicates identity FELALLGHLGYGVNFTHCAGSGEPVDDTMTYR + Deamidated (NQ); Oxidation (M)
6836 927.4214 1852.8283 1852.8374 -4.87 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
MTQGRVHVTDYTNASR + 2 Deamidated (NQ); Oxidation (M)
2249 562.7557 2246.9936 2247.0008 -3.19 1 0 3.3 +1Score > 18 indicates identity NPARQQMLPNTNGGMLNSNR + 3 Deamidated (NQ); 2 Oxidation (M)
2682 589.7679 2355.0427 2355.0511 -3.59 0 0 3.9 +1Score > 19 indicates identity GNFDTNACLWMSGLNVVDLAR + 3 Deamidated (NQ)
3020 616.7802 2463.0917 2463.1205 -11.7 0 0 3.3 +1Score > 18 indicates identity ILCCGNGTSAANAQHFAASMINR
3923 697.8171 2787.2392 2787.2408 -0.57 0 0 4.3 +1Score > 19 indicates identity GFMVLGFPCNQFLEQEPGSDEEIK + Deamidated (NQ); Oxidation (M)
5116 792.3600 3165.4111 3165.4019 2.91 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
DPDEWDYQAMEQAINAEIQSLIAACQR + Deamidated (NQ)
5621 832.8785 3327.4848 3327.5461 -18.4 0 0 4.2 +1Score > 19 indicates identity TLAMPADTNANGDIFGGWLMSQMDIGGAILAK + Deamidated (NQ); 3 Oxidation (M)
5692 832.8785 3327.4848 3327.5452 -18.2 1 0 4.2 +1Score > 19 indicates identity IQTWQYSDSQQAISIEDNGCGIDLSLQKK + 3 Deamidated (NQ)
5915 846.3846 1690.7546 1690.7832 -16.9 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
TADQGTNIQTPAQMAK + Deamidated (NQ); Oxidation (M)
5949 859.8907 3435.5339 3435.5818 -14.0 0 0 3.4 +1Score > 18 indicates identity DVNALMTAGQLINWGMPTLAAEMLNALDCQR + 3 Deamidated (NQ); Oxidation (M)
826 441.2004 1320.5795 1320.6033 -18.0 1 0 0.98 +1Score > 20 indicates identity
Score > 13 indicates homology
WYSAQHRMNK + Deamidated (NQ)
1914 535.7434 2138.9445 2138.9509 -2.96 0 0 2.9 +1Score > 18 indicates identity IYEMYSMTECIGLTCIR
2805 603.2741 1204.5337 1204.5441 -8.66 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
RGMQNTPDMR
4116 711.3232 2130.9479 2130.9503 -1.11 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
AQRVTMPMFNAFWQQNK + 3 Deamidated (NQ); 2 Oxidation (M)
5272 805.8662 3219.4357 3219.4487 -4.02 0 0 3.6 +1Score > 19 indicates identity NSFHVLDSQNNGVNANGTANGMSISLEAGQR + 2 Deamidated (NQ); Oxidation (M)
5619 832.8785 3327.4848 3327.5071 -6.69 1 0 4.2 +1Score > 19 indicates identity NCATQFISCQDSVAALGMRVLGNPYGNDPR + Deamidated (NQ); Oxidation (M)
6507 900.4092 3597.6076 3597.6558 -13.4 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
MEAAQISQTLNTPQPMINAMLQQLESMGKAVR + 5 Deamidated (NQ); 4 Oxidation (M)
6628 913.9153 1825.8160 1825.7934 12.4 1 0 4.1 +1Score > 19 indicates identity MRSEQISGSSLNPSCR + 2 Deamidated (NQ); Oxidation (M)
1150 468.2127 934.4109 934.4079 3.16 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
MQHNSYR
1330 481.7188 961.4231 961.4287 -5.82 0 0 3.1 +1Score > 18 indicates identity MTDLSHSR + Oxidation (M)
1423 495.2250 1482.6531 1482.6820 -19.5 1 0 0.98 +1Score > 20 indicates identity
Score > 13 indicates homology
GYDRAMGARPMAR + 2 Oxidation (M)
3776 684.3109 2049.9109 2049.9174 -3.15 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
NAMQDLIDHAINHADNNK + Deamidated (NQ); Oxidation (M)
6477 900.4092 3597.6076 3597.6558 -13.4 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
MEAAQISQTLNTPQPMINAMLQQLESMGKAVR + 5 Deamidated (NQ); 4 Oxidation (M)
Page: Previous 1 12 13 14 15 16 17 18 19 20 21 22  76 Next 

Not what you expected? Try the select summary.