MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 4 Dec 2025 at 15:28:39 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1501–1600 (out of 7566)


Page: Previous 1 11 12 13 14 15 16 17 18 19 20 21  76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3139 630.2864 2517.1164 2517.1127 1.48 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
MFSMHNCQINPGAGPEITTPWK + 2 Deamidated (NQ)
3609 670.8048 2679.1901 2679.2309 -15.2 1 1 3.8 +1Score > 19 indicates identity ENTWVIYTSDHGEMMGAHKLISK + Deamidated (NQ); 2 Oxidation (M)
6168 873.3969 3489.5585 3489.5163 12.1 0 1 0.86 +1Score > 22 indicates identity
Score > 13 indicates homology
VHFMICQQQDDEIEAGIEHLHQLYNVMR + 5 Deamidated (NQ); 2 Oxidation (M)
6496 900.4092 1798.8038 1798.8151 -6.27 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
VMQVSAMADQMLLDSK + Deamidated (NQ); 2 Oxidation (M)
611 427.6943 1706.7481 1706.7437 2.58 0 1 1.7 +1Score > 16 indicates identity QWVNNGFAGWNGQAR + 3 Deamidated (NQ)
5593 819.3723 2455.0951 2455.1393 -18.0 1 1 0.95 +1Score > 21 indicates identity
Score > 13 indicates homology
NISKNMQNTMGQVTTSAEQMLK + 2 Deamidated (NQ)
6241 873.3969 2617.1689 2617.1954 -10.1 1 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
QAHWNMRGANFIAVHEMLDGFR + 2 Deamidated (NQ); Oxidation (M)
207 400.6820 1598.6989 1598.6804 11.6 0 1 1.8 +1Score > 16 indicates identity VIDQGTGETMGDMTK + Deamidated (NQ); Oxidation (M)
2984 616.7802 2463.0917 2463.0570 14.1 1 1 3 +1Score > 18 indicates identity LNKEMVEGMGGTQSEQYQEFR + 3 Deamidated (NQ)
771 441.2004 1320.5795 1320.5980 -14.0 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
TLGEMNGDAELR + Oxidation (M)
800 441.2004 1320.5795 1320.5656 10.5 0 1 0.94 +1Score > 20 indicates identity
Score > 13 indicates homology
MDAWLSGPNANK + 2 Deamidated (NQ); Oxidation (M)
1546 508.7311 2030.8955 2030.9037 -4.05 1 1 2.2 +1Score > 17 indicates identity VAAQHSMMPAETESEKER + Deamidated (NQ)
3972 697.8171 2787.2392 2787.2869 -17.1 0 1 3.9 +1Score > 19 indicates identity SSIMVGEVDATTASGIHGLADENEDIR + Deamidated (NQ)
4717 751.8416 3003.3374 3003.3704 -11.0 0 1 3.6 +1Score > 19 indicates identity LSHTCFQVLAYEPYLELCEIMNQK + 2 Deamidated (NQ); Oxidation (M)
432 414.1881 1652.7235 1652.7069 10.0 1 1 3.8 +1Score > 19 indicates identity RMGELMAESHASMR + 3 Oxidation (M)
1417 495.2250 988.4354 988.4462 -10.9 0 1 0.87 +1Score > 20 indicates identity
Score > 13 indicates homology
GVDDADQLR + Deamidated (NQ)
2291 562.7557 1123.4968 1123.4790 15.8 0 1 3.1 +1Score > 18 indicates identity LMDWNMSAR + Deamidated (NQ)
3641 670.8048 2679.1901 2679.1801 3.75 1 1 3.8 +1Score > 19 indicates identity KQGSMYIMNSTENMPFIDLQCR + Deamidated (NQ); Oxidation (M)
1302 481.7188 1922.8463 1922.8832 -19.2 0 1 2.9 +1Score > 18 indicates identity WAESCLEFQVAQEIGR + Deamidated (NQ)
4686 751.8416 3003.3374 3003.3808 -14.5 0 1 3.6 +1Score > 19 indicates identity AQMINSYDNSVTYVDHFISSVIDQVR + 3 Deamidated (NQ)
5360 805.8662 3219.4357 3219.4821 -14.4 1 1 3.3 +1Score > 19 indicates identity QMVSVATAMIPFLEHDDANRALMGANMQR + 3 Deamidated (NQ)
5874 846.3846 1690.7546 1690.7841 -17.4 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
HCQETGLSLSGLMMK
6976 940.9276 3759.6811 3759.6935 -3.30 0 1 3.9 +1Score > 19 indicates identity LMIALEMIGYYDSAPGSQNYPYPAMSWLYPDR + 3 Oxidation (M)
1165 468.2127 934.4109 934.4066 4.60 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
EPNMAETK + Oxidation (M)
1179 468.2127 1868.8217 1868.8019 10.6 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
DLTANTMPGSNDIMEVK + 2 Deamidated (NQ); 2 Oxidation (M)
1756 522.2372 2084.9199 2084.9287 -4.22 0 1 4 +1Score > 19 indicates identity QTSLNGFYQDNGGDADLLR + 2 Deamidated (NQ)
2495 576.2618 2301.0183 2301.0327 -6.26 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
MWMAGQGTIQISDQMNIKAK + 3 Deamidated (NQ); 3 Oxidation (M)
1657 508.7311 1015.4477 1015.4319 15.6 0 1 2.3 +1Score > 17 indicates identity HSNGEQTSR + Deamidated (NQ)
2715 589.7679 1177.5213 1177.5437 -19.0 0 1 3.6 +1Score > 19 indicates identity MFPDSPAAAGSK
3553 657.2986 2625.1655 2625.2030 -14.3 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
QGREMIQWSSPKPQNGDWHIGR + 3 Deamidated (NQ); Oxidation (M)
3917 697.8171 2787.2392 2787.2156 8.46 0 1 4 +1Score > 19 indicates identity LEDTGMGEQMQEYAVSQVLHWFR + 2 Deamidated (NQ); 2 Oxidation (M)
7489 980.1954 2937.5645 2937.5382 8.94 1 1 3.1 +1Score > 18 indicates identity IAAWLTPDTIPGLDTLDLMQAQQVRR + Oxidation (M)
1402 495.2250 1482.6531 1482.6521 0.67 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
MNNNDLFQASRR + 2 Deamidated (NQ); Oxidation (M)
2199 549.2496 1096.4846 1096.5036 -17.4 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
LSTSFQEER + Deamidated (NQ)
4473 738.3355 2949.3129 2949.3516 -13.1 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
AGDIAPKFSLPDQDGEQVNLTDFQGQR + 4 Deamidated (NQ)
5712 832.8785 3327.4848 3327.5461 -18.4 1 1 3.9 +1Score > 19 indicates identity DYLHIDMAASYMVGDKLEDMQAAVAANVGTK + Deamidated (NQ)
1205 481.7188 961.4231 961.4063 17.6 0 1 2.9 +1Score > 18 indicates identity METPQPDK + Deamidated (NQ); Oxidation (M)
2117 549.2496 2192.9692 2192.9749 -2.63 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
FDYSEDSLSPAYNVTAAQSK + Deamidated (NQ)
5298 805.8662 3219.4357 3219.4356 0.051 1 1 3.3 +1Score > 19 indicates identity LKVSEGWQNGWWASMESNTWNTIHDNK + 2 Deamidated (NQ)
5506 819.3723 3273.4602 3273.4516 2.63 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
ERLDGIVMFADDSNMHSMELFDEIQSVK + 2 Deamidated (NQ); Oxidation (M)
6561 900.4092 1798.8038 1798.8057 -1.03 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
EQGVNSHVEMAAAFHR + Deamidated (NQ); Oxidation (M)
532 427.6943 1706.7481 1706.7790 -18.1 0 1 1.8 +1Score > 16 indicates identity HCQETGLSLSGLMMK + Oxidation (M)
4024 697.8171 2787.2392 2787.2309 2.99 1 1 4 +1Score > 19 indicates identity HDPDNKFAMPYMWATTGIGYNVDK + Deamidated (NQ); Oxidation (M)
6179 873.3969 2617.1689 2617.1238 17.2 0 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
NPVSGEVLWQGNDADAAQVEQACR + 4 Deamidated (NQ)
6713 913.9153 1825.8160 1825.8226 -3.62 0 1 3.8 +1Score > 19 indicates identity DIGMPELSDEMLGFTR + Oxidation (M)
7194 954.4337 2860.2793 2860.3259 -16.3 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
SYYINQGTPAQLGGMLVDMAARQVNK + 4 Deamidated (NQ); 2 Oxidation (M)
7381 967.9399 1933.8652 1933.9017 -18.9 0 1 3.9 +1Score > 19 indicates identity NAIGNYITSGELPDENAR + Deamidated (NQ)
86 387.1759 1158.5058 1158.4831 19.6 0 1 2 +1Score > 16 indicates identity TLNMAMSGMR + 3 Oxidation (M)
985 454.7066 907.3986 907.3817 18.6 1 1 2.6 +1Score > 17 indicates identity RDNQAMR + 2 Deamidated (NQ); Oxidation (M)
1392 495.2250 988.4354 988.4219 13.7 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
GNHEVMMR + Oxidation (M)
2704 589.7679 1177.5213 1177.5291 -6.63 0 1 3.6 +1Score > 19 indicates identity AIDFSDGYYK
3434 657.2986 1968.8741 1968.8809 -3.43 1 1 0.86 +1Score > 21 indicates identity
Score > 13 indicates homology
MVETSQCVPYPAKADEK + Deamidated (NQ); Oxidation (M)
4047 697.8171 1393.6196 1393.6257 -4.41 0 1 4 +1Score > 19 indicates identity MAVMPEEELWK + 2 Oxidation (M)
5378 805.8662 3219.4357 3219.4666 -9.58 1 1 3.3 +1Score > 19 indicates identity TNVDLQIRIMNDENFQHGGTNIHYLEK + 5 Deamidated (NQ); Oxidation (M)
968 454.7066 907.3986 907.4069 -9.16 0 1 2.6 +1Score > 17 indicates identity AALDNMTR + Deamidated (NQ); Oxidation (M)
2862 603.2741 1806.8005 1806.8240 -13.0 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
EEARGEQNNMVMILR + 2 Deamidated (NQ); Oxidation (M)
6521 900.4092 1798.8038 1798.8155 -6.52 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
ASAEEIQDHQCEILR + Deamidated (NQ)
147 387.1759 1158.5058 1158.4984 6.39 0 1 2 +1Score > 16 indicates identity LHAMMHQMK + Deamidated (NQ); 2 Oxidation (M)
1579 508.7311 2030.8955 2030.9196 -11.9 1 1 2.3 +1Score > 17 indicates identity RSNIAEWFYTPGWMEK + Deamidated (NQ); Oxidation (M)
2579 589.7679 2355.0427 2355.0583 -6.63 1 1 3.6 +1Score > 19 indicates identity AEMLQQANALDERESFSNMR + Oxidation (M)
3579 670.8048 1339.5951 1339.5788 12.2 0 1 3.9 +1Score > 19 indicates identity NMWILMEENK + Deamidated (NQ); 2 Oxidation (M)
4872 765.3478 2293.0215 2293.0507 -12.7 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
GMWVDDKWMLITGNNLNPR + 2 Deamidated (NQ); 2 Oxidation (M)
1625 508.7311 2030.8955 2030.9037 -4.05 1 1 2.3 +1Score > 17 indicates identity HGNSEMQKINQTSAMPEK + 2 Deamidated (NQ)
1762 522.2372 1042.4599 1042.4576 2.26 0 1 4.1 +1Score > 19 indicates identity GFADAIMMR + 2 Oxidation (M)
2654 589.7679 1177.5213 1177.5397 -15.6 0 1 3.6 +1Score > 19 indicates identity MVTPAGGSGTER + Oxidation (M)
4630 751.8416 3003.3374 3003.3040 11.1 0 1 3.6 +1Score > 19 indicates identity TDGMQVAINNTNGATFALTNGNNDINFR + 5 Deamidated (NQ); Oxidation (M)
382 414.1881 1239.5426 1239.5666 -19.4 1 1 3.9 +1Score > 19 indicates identity GFDAMRSGQSGK
3758 684.3109 2049.9109 2049.9500 -19.0 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
QDAVQHAQQLLKMMGYGV + 2 Deamidated (NQ); 2 Oxidation (M)
2578 589.7679 1177.5213 1177.5397 -15.6 0 1 3.7 +1Score > 19 indicates identity MVTPAGGSGTER + Oxidation (M)
2970 616.7802 2463.0917 2463.0617 12.2 1 1 3.1 +1Score > 18 indicates identity QMAARLECGGVFINGYCASDAR + 2 Deamidated (NQ); Oxidation (M)
3090 630.2864 2517.1164 2517.0722 17.5 1 1 0.88 +1Score > 20 indicates identity
Score > 13 indicates homology
NNYIHDLDMAAERMFTESGMR + Deamidated (NQ); Oxidation (M)
66 387.1759 1544.6744 1544.6889 -9.41 0 1 2.1 +1Score > 16 indicates identity QAGCTLHEVGTTNR + 2 Deamidated (NQ)
2154 549.2496 1644.7269 1644.7314 -2.77 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
QDLCHFEGNAQGIR + Deamidated (NQ)
2453 576.2618 1725.7637 1725.7945 -17.8 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
LKDLETQSQDGTFDK + 2 Deamidated (NQ)
6081 859.8907 3435.5339 3435.5680 -9.92 0 1 3.2 +1Score > 18 indicates identity TSTITAPVVCHHCEEAPCLQVCPVNAISQR + 2 Deamidated (NQ)
264 400.6820 1598.6989 1598.6990 -0.051 0 1 1.9 +1Score > 16 indicates identity SDVTPALSEMMQMK + 2 Oxidation (M)
1768 522.2372 1563.6899 1563.6909 -0.61 1 1 4.1 +1Score > 19 indicates identity ICSPQNNTGAPMKK + 3 Deamidated (NQ); Oxidation (M)
2307 562.7557 1123.4968 1123.4824 12.8 1 1 3.2 +1Score > 18 indicates identity RQMMGMEPK + Deamidated (NQ); Oxidation (M)
2791 603.2741 2409.0673 2409.1086 -17.1 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
AGTMSGGEQQMLAIGRALMSNPR + 2 Deamidated (NQ); 2 Oxidation (M)
2802 603.2741 1806.8005 1806.8314 -17.1 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
TVAAEMPAMQCLQLAR + 2 Deamidated (NQ); Oxidation (M)
5212 792.3600 3165.4111 3165.4648 -17.0 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
QGLMIEQHVEAELANDPPNDLMWWRR + 2 Deamidated (NQ); Oxidation (M)
5498 819.3723 1636.7301 1636.7324 -1.41 0 1 0.89 +1Score > 21 indicates identity
Score > 13 indicates homology
EMVSEMVANDLEAAK + Deamidated (NQ)
7504 980.1954 2937.5645 2937.5250 13.5 1 1 3.2 +1Score > 18 indicates identity YQTPHHRLQSGIDAVLHVLDWVPVR + 2 Deamidated (NQ)
1668 508.7311 2030.8955 2030.9116 -7.93 1 1 2.3 +1Score > 17 indicates identity NNGRDHVIVASDPNAMYR + 3 Deamidated (NQ)
1894 535.7434 2138.9445 2138.9612 -7.81 1 1 2.8 +1Score > 18 indicates identity VPDPQMSMENLVESKHHK + 2 Deamidated (NQ); 2 Oxidation (M)
1921 535.7434 1069.4723 1069.4862 -13.1 0 1 2.8 +1Score > 18 indicates identity YCVNSASLR + Deamidated (NQ)
3449 657.2986 1968.8741 1968.9034 -14.9 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
KCEMTGGIGSYSAGTPTPR
33 387.1759 1544.6744 1544.6889 -9.41 0 1 2.1 +1Score > 16 indicates identity QAGCTLHEVGTTNR + 2 Deamidated (NQ)
1452 495.2250 1976.8708 1976.8828 -6.08 0 1 0.96 +1Score > 20 indicates identity
Score > 13 indicates homology
GCMGVDIGSAMTYMLLAR + 2 Oxidation (M)
3274 643.7925 2571.1411 2571.1655 -9.50 1 1 3.4 +1Score > 18 indicates identity MTANLQPGEYDMTCGLLTNPKGK + Deamidated (NQ); 2 Oxidation (M)
6151 873.3969 2617.1689 2617.2006 -12.1 0 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
WLEQSKPVSCLAHYQQSPEAEK + 3 Deamidated (NQ)
6152 873.3969 2617.1689 2617.2053 -13.9 1 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
AVFERTWMGDEANMPQTLQEHK
5389 805.8662 3219.4357 3219.4765 -12.7 0 1 3.4 +1Score > 19 indicates identity NADALIVEADVSTSDTPFANLPACEALEER + 2 Deamidated (NQ)
5876 846.3846 1690.7546 1690.7841 -17.4 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
HCQETGLSLSGLMMK
5948 859.8907 3435.5339 3435.5929 -17.2 1 1 3.2 +1Score > 18 indicates identity RQMLNEHYDVTTAAYAVGYESYPISVGNIR + 3 Deamidated (NQ); Oxidation (M)
4861 765.3478 2293.0215 2293.0233 -0.80 0 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
DALYQAIDDALEQSAPATDER + 2 Deamidated (NQ)
1754 522.2372 2084.9199 2084.9176 1.07 1 1 4.2 +1Score > 19 indicates identity MTTLNCSGQCRLQAVEAK + 3 Deamidated (NQ); Oxidation (M)
5547 819.3723 2455.0951 2455.1220 -10.9 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
DYSELNVAQGQEMIAQRGMSGR + Oxidation (M)
5631 832.8785 1663.7424 1663.7478 -3.23 0 1 4 +1Score > 19 indicates identity FGDNLQAWLEQNAR + 3 Deamidated (NQ)
5860 846.3846 3381.5092 3381.5713 -18.3 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
IGNMLLGGLVYPLTCQPQDMLQAMEENRR + 3 Deamidated (NQ); 2 Oxidation (M)
Page: Previous 1 11 12 13 14 15 16 17 18 19 20 21  76 Next 

Not what you expected? Try the select summary.