| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | test |
| MS data file | : | PRT1346_ENIGMA_14.mgf |
| Database | : | Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues) |
| Timestamp | : | 4 Dec 2025 at 15:28:39 GMT |
Not what you expected? Try
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | |
| Variable modifications | : | |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 7,621 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 | 2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | ||||
| 6.2e-007 | 1 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | ||||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle (
) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 630.2864 | 2517.1164 | 2517.1127 | 1.48 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
MFSMHNCQINPGAGPEITTPWK + 2 Deamidated (NQ) | |
| 670.8048 | 2679.1901 | 2679.2309 | -15.2 | 1 | 1 | 3.8 | 1Score > 19 indicates identity |
ENTWVIYTSDHGEMMGAHKLISK + Deamidated (NQ); 2 Oxidation (M) | |
| 873.3969 | 3489.5585 | 3489.5163 | 12.1 | 0 | 1 | 0.86 | 1Score > 22 indicates identityScore > 13 indicates homology |
VHFMICQQQDDEIEAGIEHLHQLYNVMR + 5 Deamidated (NQ); 2 Oxidation (M) | |
| 900.4092 | 1798.8038 | 1798.8151 | -6.27 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
VMQVSAMADQMLLDSK + Deamidated (NQ); 2 Oxidation (M) | |
| 427.6943 | 1706.7481 | 1706.7437 | 2.58 | 0 | 1 | 1.7 | 1Score > 16 indicates identity |
QWVNNGFAGWNGQAR + 3 Deamidated (NQ) | |
| 819.3723 | 2455.0951 | 2455.1393 | -18.0 | 1 | 1 | 0.95 | 1Score > 21 indicates identityScore > 13 indicates homology |
NISKNMQNTMGQVTTSAEQMLK + 2 Deamidated (NQ) | |
| 873.3969 | 2617.1689 | 2617.1954 | -10.1 | 1 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
QAHWNMRGANFIAVHEMLDGFR + 2 Deamidated (NQ); Oxidation (M) | |
| 400.6820 | 1598.6989 | 1598.6804 | 11.6 | 0 | 1 | 1.8 | 1Score > 16 indicates identity |
VIDQGTGETMGDMTK + Deamidated (NQ); Oxidation (M) | |
| 616.7802 | 2463.0917 | 2463.0570 | 14.1 | 1 | 1 | 3 | 1Score > 18 indicates identity |
LNKEMVEGMGGTQSEQYQEFR + 3 Deamidated (NQ) | |
| 441.2004 | 1320.5795 | 1320.5980 | -14.0 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
TLGEMNGDAELR + Oxidation (M) | |
| 441.2004 | 1320.5795 | 1320.5656 | 10.5 | 0 | 1 | 0.94 | 1Score > 20 indicates identityScore > 13 indicates homology |
MDAWLSGPNANK + 2 Deamidated (NQ); Oxidation (M) | |
| 508.7311 | 2030.8955 | 2030.9037 | -4.05 | 1 | 1 | 2.2 | 1Score > 17 indicates identity |
VAAQHSMMPAETESEKER + Deamidated (NQ) | |
| 697.8171 | 2787.2392 | 2787.2869 | -17.1 | 0 | 1 | 3.9 | 1Score > 19 indicates identity |
SSIMVGEVDATTASGIHGLADENEDIR + Deamidated (NQ) | |
| 751.8416 | 3003.3374 | 3003.3704 | -11.0 | 0 | 1 | 3.6 | 1Score > 19 indicates identity |
LSHTCFQVLAYEPYLELCEIMNQK + 2 Deamidated (NQ); Oxidation (M) | |
| 414.1881 | 1652.7235 | 1652.7069 | 10.0 | 1 | 1 | 3.8 | 1Score > 19 indicates identity |
RMGELMAESHASMR + 3 Oxidation (M) | |
| 495.2250 | 988.4354 | 988.4462 | -10.9 | 0 | 1 | 0.87 | 1Score > 20 indicates identityScore > 13 indicates homology |
GVDDADQLR + Deamidated (NQ) | |
| 562.7557 | 1123.4968 | 1123.4790 | 15.8 | 0 | 1 | 3.1 | 1Score > 18 indicates identity |
LMDWNMSAR + Deamidated (NQ) | |
| 670.8048 | 2679.1901 | 2679.1801 | 3.75 | 1 | 1 | 3.8 | 1Score > 19 indicates identity |
KQGSMYIMNSTENMPFIDLQCR + Deamidated (NQ); Oxidation (M) | |
| 481.7188 | 1922.8463 | 1922.8832 | -19.2 | 0 | 1 | 2.9 | 1Score > 18 indicates identity |
WAESCLEFQVAQEIGR + Deamidated (NQ) | |
| 751.8416 | 3003.3374 | 3003.3808 | -14.5 | 0 | 1 | 3.6 | 1Score > 19 indicates identity |
AQMINSYDNSVTYVDHFISSVIDQVR + 3 Deamidated (NQ) | |
| 805.8662 | 3219.4357 | 3219.4821 | -14.4 | 1 | 1 | 3.3 | 1Score > 19 indicates identity |
QMVSVATAMIPFLEHDDANRALMGANMQR + 3 Deamidated (NQ) | |
| 846.3846 | 1690.7546 | 1690.7841 | -17.4 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
HCQETGLSLSGLMMK | |
| 940.9276 | 3759.6811 | 3759.6935 | -3.30 | 0 | 1 | 3.9 | 1Score > 19 indicates identity |
LMIALEMIGYYDSAPGSQNYPYPAMSWLYPDR + 3 Oxidation (M) | |
| 468.2127 | 934.4109 | 934.4066 | 4.60 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
EPNMAETK + Oxidation (M) | |
| 468.2127 | 1868.8217 | 1868.8019 | 10.6 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
DLTANTMPGSNDIMEVK + 2 Deamidated (NQ); 2 Oxidation (M) | |
| 522.2372 | 2084.9199 | 2084.9287 | -4.22 | 0 | 1 | 4 | 1Score > 19 indicates identity |
QTSLNGFYQDNGGDADLLR + 2 Deamidated (NQ) | |
| 576.2618 | 2301.0183 | 2301.0327 | -6.26 | 1 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
MWMAGQGTIQISDQMNIKAK + 3 Deamidated (NQ); 3 Oxidation (M) | |
| 508.7311 | 1015.4477 | 1015.4319 | 15.6 | 0 | 1 | 2.3 | 1Score > 17 indicates identity |
HSNGEQTSR + Deamidated (NQ) | |
| 589.7679 | 1177.5213 | 1177.5437 | -19.0 | 0 | 1 | 3.6 | 1Score > 19 indicates identity |
MFPDSPAAAGSK | |
| 657.2986 | 2625.1655 | 2625.2030 | -14.3 | 1 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
QGREMIQWSSPKPQNGDWHIGR + 3 Deamidated (NQ); Oxidation (M) | |
| 697.8171 | 2787.2392 | 2787.2156 | 8.46 | 0 | 1 | 4 | 1Score > 19 indicates identity |
LEDTGMGEQMQEYAVSQVLHWFR + 2 Deamidated (NQ); 2 Oxidation (M) | |
| 980.1954 | 2937.5645 | 2937.5382 | 8.94 | 1 | 1 | 3.1 | 1Score > 18 indicates identity |
IAAWLTPDTIPGLDTLDLMQAQQVRR + Oxidation (M) | |
| 495.2250 | 1482.6531 | 1482.6521 | 0.67 | 1 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
MNNNDLFQASRR + 2 Deamidated (NQ); Oxidation (M) | |
| 549.2496 | 1096.4846 | 1096.5036 | -17.4 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
LSTSFQEER + Deamidated (NQ) | |
| 738.3355 | 2949.3129 | 2949.3516 | -13.1 | 1 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
AGDIAPKFSLPDQDGEQVNLTDFQGQR + 4 Deamidated (NQ) | |
| 832.8785 | 3327.4848 | 3327.5461 | -18.4 | 1 | 1 | 3.9 | 1Score > 19 indicates identity |
DYLHIDMAASYMVGDKLEDMQAAVAANVGTK + Deamidated (NQ) | |
| 481.7188 | 961.4231 | 961.4063 | 17.6 | 0 | 1 | 2.9 | 1Score > 18 indicates identity |
METPQPDK + Deamidated (NQ); Oxidation (M) | |
| 549.2496 | 2192.9692 | 2192.9749 | -2.63 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
FDYSEDSLSPAYNVTAAQSK + Deamidated (NQ) | |
| 805.8662 | 3219.4357 | 3219.4356 | 0.051 | 1 | 1 | 3.3 | 1Score > 19 indicates identity |
LKVSEGWQNGWWASMESNTWNTIHDNK + 2 Deamidated (NQ) | |
| 819.3723 | 3273.4602 | 3273.4516 | 2.63 | 1 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
ERLDGIVMFADDSNMHSMELFDEIQSVK + 2 Deamidated (NQ); Oxidation (M) | |
| 900.4092 | 1798.8038 | 1798.8057 | -1.03 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
EQGVNSHVEMAAAFHR + Deamidated (NQ); Oxidation (M) | |
| 427.6943 | 1706.7481 | 1706.7790 | -18.1 | 0 | 1 | 1.8 | 1Score > 16 indicates identity |
HCQETGLSLSGLMMK + Oxidation (M) | |
| 697.8171 | 2787.2392 | 2787.2309 | 2.99 | 1 | 1 | 4 | 1Score > 19 indicates identity |
HDPDNKFAMPYMWATTGIGYNVDK + Deamidated (NQ); Oxidation (M) | |
| 873.3969 | 2617.1689 | 2617.1238 | 17.2 | 0 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
NPVSGEVLWQGNDADAAQVEQACR + 4 Deamidated (NQ) | |
| 913.9153 | 1825.8160 | 1825.8226 | -3.62 | 0 | 1 | 3.8 | 1Score > 19 indicates identity |
DIGMPELSDEMLGFTR + Oxidation (M) | |
| 954.4337 | 2860.2793 | 2860.3259 | -16.3 | 1 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
SYYINQGTPAQLGGMLVDMAARQVNK + 4 Deamidated (NQ); 2 Oxidation (M) | |
| 967.9399 | 1933.8652 | 1933.9017 | -18.9 | 0 | 1 | 3.9 | 1Score > 19 indicates identity |
NAIGNYITSGELPDENAR + Deamidated (NQ) | |
| 387.1759 | 1158.5058 | 1158.4831 | 19.6 | 0 | 1 | 2 | 1Score > 16 indicates identity |
TLNMAMSGMR + 3 Oxidation (M) | |
| 454.7066 | 907.3986 | 907.3817 | 18.6 | 1 | 1 | 2.6 | 1Score > 17 indicates identity |
RDNQAMR + 2 Deamidated (NQ); Oxidation (M) | |
| 495.2250 | 988.4354 | 988.4219 | 13.7 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
GNHEVMMR + Oxidation (M) | |
| 589.7679 | 1177.5213 | 1177.5291 | -6.63 | 0 | 1 | 3.6 | 1Score > 19 indicates identity |
AIDFSDGYYK | |
| 657.2986 | 1968.8741 | 1968.8809 | -3.43 | 1 | 1 | 0.86 | 1Score > 21 indicates identityScore > 13 indicates homology |
MVETSQCVPYPAKADEK + Deamidated (NQ); Oxidation (M) | |
| 697.8171 | 1393.6196 | 1393.6257 | -4.41 | 0 | 1 | 4 | 1Score > 19 indicates identity |
MAVMPEEELWK + 2 Oxidation (M) | |
| 805.8662 | 3219.4357 | 3219.4666 | -9.58 | 1 | 1 | 3.3 | 1Score > 19 indicates identity |
TNVDLQIRIMNDENFQHGGTNIHYLEK + 5 Deamidated (NQ); Oxidation (M) | |
| 454.7066 | 907.3986 | 907.4069 | -9.16 | 0 | 1 | 2.6 | 1Score > 17 indicates identity |
AALDNMTR + Deamidated (NQ); Oxidation (M) | |
| 603.2741 | 1806.8005 | 1806.8240 | -13.0 | 1 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
EEARGEQNNMVMILR + 2 Deamidated (NQ); Oxidation (M) | |
| 900.4092 | 1798.8038 | 1798.8155 | -6.52 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
ASAEEIQDHQCEILR + Deamidated (NQ) | |
| 387.1759 | 1158.5058 | 1158.4984 | 6.39 | 0 | 1 | 2 | 1Score > 16 indicates identity |
LHAMMHQMK + Deamidated (NQ); 2 Oxidation (M) | |
| 508.7311 | 2030.8955 | 2030.9196 | -11.9 | 1 | 1 | 2.3 | 1Score > 17 indicates identity |
RSNIAEWFYTPGWMEK + Deamidated (NQ); Oxidation (M) | |
| 589.7679 | 2355.0427 | 2355.0583 | -6.63 | 1 | 1 | 3.6 | 1Score > 19 indicates identity |
AEMLQQANALDERESFSNMR + Oxidation (M) | |
| 670.8048 | 1339.5951 | 1339.5788 | 12.2 | 0 | 1 | 3.9 | 1Score > 19 indicates identity |
NMWILMEENK + Deamidated (NQ); 2 Oxidation (M) | |
| 765.3478 | 2293.0215 | 2293.0507 | -12.7 | 1 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
GMWVDDKWMLITGNNLNPR + 2 Deamidated (NQ); 2 Oxidation (M) | |
| 508.7311 | 2030.8955 | 2030.9037 | -4.05 | 1 | 1 | 2.3 | 1Score > 17 indicates identity |
HGNSEMQKINQTSAMPEK + 2 Deamidated (NQ) | |
| 522.2372 | 1042.4599 | 1042.4576 | 2.26 | 0 | 1 | 4.1 | 1Score > 19 indicates identity |
GFADAIMMR + 2 Oxidation (M) | |
| 589.7679 | 1177.5213 | 1177.5397 | -15.6 | 0 | 1 | 3.6 | 1Score > 19 indicates identity |
MVTPAGGSGTER + Oxidation (M) | |
| 751.8416 | 3003.3374 | 3003.3040 | 11.1 | 0 | 1 | 3.6 | 1Score > 19 indicates identity |
TDGMQVAINNTNGATFALTNGNNDINFR + 5 Deamidated (NQ); Oxidation (M) | |
| 414.1881 | 1239.5426 | 1239.5666 | -19.4 | 1 | 1 | 3.9 | 1Score > 19 indicates identity |
GFDAMRSGQSGK | |
| 684.3109 | 2049.9109 | 2049.9500 | -19.0 | 1 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
QDAVQHAQQLLKMMGYGV + 2 Deamidated (NQ); 2 Oxidation (M) | |
| 589.7679 | 1177.5213 | 1177.5397 | -15.6 | 0 | 1 | 3.7 | 1Score > 19 indicates identity |
MVTPAGGSGTER + Oxidation (M) | |
| 616.7802 | 2463.0917 | 2463.0617 | 12.2 | 1 | 1 | 3.1 | 1Score > 18 indicates identity |
QMAARLECGGVFINGYCASDAR + 2 Deamidated (NQ); Oxidation (M) | |
| 630.2864 | 2517.1164 | 2517.0722 | 17.5 | 1 | 1 | 0.88 | 1Score > 20 indicates identityScore > 13 indicates homology |
NNYIHDLDMAAERMFTESGMR + Deamidated (NQ); Oxidation (M) | |
| 387.1759 | 1544.6744 | 1544.6889 | -9.41 | 0 | 1 | 2.1 | 1Score > 16 indicates identity |
QAGCTLHEVGTTNR + 2 Deamidated (NQ) | |
| 549.2496 | 1644.7269 | 1644.7314 | -2.77 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
QDLCHFEGNAQGIR + Deamidated (NQ) | |
| 576.2618 | 1725.7637 | 1725.7945 | -17.8 | 1 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
LKDLETQSQDGTFDK + 2 Deamidated (NQ) | |
| 859.8907 | 3435.5339 | 3435.5680 | -9.92 | 0 | 1 | 3.2 | 1Score > 18 indicates identity |
TSTITAPVVCHHCEEAPCLQVCPVNAISQR + 2 Deamidated (NQ) | |
| 400.6820 | 1598.6989 | 1598.6990 | -0.051 | 0 | 1 | 1.9 | 1Score > 16 indicates identity |
SDVTPALSEMMQMK + 2 Oxidation (M) | |
| 522.2372 | 1563.6899 | 1563.6909 | -0.61 | 1 | 1 | 4.1 | 1Score > 19 indicates identity |
ICSPQNNTGAPMKK + 3 Deamidated (NQ); Oxidation (M) | |
| 562.7557 | 1123.4968 | 1123.4824 | 12.8 | 1 | 1 | 3.2 | 1Score > 18 indicates identity |
RQMMGMEPK + Deamidated (NQ); Oxidation (M) | |
| 603.2741 | 2409.0673 | 2409.1086 | -17.1 | 1 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
AGTMSGGEQQMLAIGRALMSNPR + 2 Deamidated (NQ); 2 Oxidation (M) | |
| 603.2741 | 1806.8005 | 1806.8314 | -17.1 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
TVAAEMPAMQCLQLAR + 2 Deamidated (NQ); Oxidation (M) | |
| 792.3600 | 3165.4111 | 3165.4648 | -17.0 | 1 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
QGLMIEQHVEAELANDPPNDLMWWRR + 2 Deamidated (NQ); Oxidation (M) | |
| 819.3723 | 1636.7301 | 1636.7324 | -1.41 | 0 | 1 | 0.89 | 1Score > 21 indicates identityScore > 13 indicates homology |
EMVSEMVANDLEAAK + Deamidated (NQ) | |
| 980.1954 | 2937.5645 | 2937.5250 | 13.5 | 1 | 1 | 3.2 | 1Score > 18 indicates identity |
YQTPHHRLQSGIDAVLHVLDWVPVR + 2 Deamidated (NQ) | |
| 508.7311 | 2030.8955 | 2030.9116 | -7.93 | 1 | 1 | 2.3 | 1Score > 17 indicates identity |
NNGRDHVIVASDPNAMYR + 3 Deamidated (NQ) | |
| 535.7434 | 2138.9445 | 2138.9612 | -7.81 | 1 | 1 | 2.8 | 1Score > 18 indicates identity |
VPDPQMSMENLVESKHHK + 2 Deamidated (NQ); 2 Oxidation (M) | |
| 535.7434 | 1069.4723 | 1069.4862 | -13.1 | 0 | 1 | 2.8 | 1Score > 18 indicates identity |
YCVNSASLR + Deamidated (NQ) | |
| 657.2986 | 1968.8741 | 1968.9034 | -14.9 | 1 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
KCEMTGGIGSYSAGTPTPR | |
| 387.1759 | 1544.6744 | 1544.6889 | -9.41 | 0 | 1 | 2.1 | 1Score > 16 indicates identity |
QAGCTLHEVGTTNR + 2 Deamidated (NQ) | |
| 495.2250 | 1976.8708 | 1976.8828 | -6.08 | 0 | 1 | 0.96 | 1Score > 20 indicates identityScore > 13 indicates homology |
GCMGVDIGSAMTYMLLAR + 2 Oxidation (M) | |
| 643.7925 | 2571.1411 | 2571.1655 | -9.50 | 1 | 1 | 3.4 | 1Score > 18 indicates identity |
MTANLQPGEYDMTCGLLTNPKGK + Deamidated (NQ); 2 Oxidation (M) | |
| 873.3969 | 2617.1689 | 2617.2006 | -12.1 | 0 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
WLEQSKPVSCLAHYQQSPEAEK + 3 Deamidated (NQ) | |
| 873.3969 | 2617.1689 | 2617.2053 | -13.9 | 1 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
AVFERTWMGDEANMPQTLQEHK | |
| 805.8662 | 3219.4357 | 3219.4765 | -12.7 | 0 | 1 | 3.4 | 1Score > 19 indicates identity |
NADALIVEADVSTSDTPFANLPACEALEER + 2 Deamidated (NQ) | |
| 846.3846 | 1690.7546 | 1690.7841 | -17.4 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
HCQETGLSLSGLMMK | |
| 859.8907 | 3435.5339 | 3435.5929 | -17.2 | 1 | 1 | 3.2 | 1Score > 18 indicates identity |
RQMLNEHYDVTTAAYAVGYESYPISVGNIR + 3 Deamidated (NQ); Oxidation (M) | |
| 765.3478 | 2293.0215 | 2293.0233 | -0.80 | 0 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
DALYQAIDDALEQSAPATDER + 2 Deamidated (NQ) | |
| 522.2372 | 2084.9199 | 2084.9176 | 1.07 | 1 | 1 | 4.2 | 1Score > 19 indicates identity |
MTTLNCSGQCRLQAVEAK + 3 Deamidated (NQ); Oxidation (M) | |
| 819.3723 | 2455.0951 | 2455.1220 | -10.9 | 1 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
DYSELNVAQGQEMIAQRGMSGR + Oxidation (M) | |
| 832.8785 | 1663.7424 | 1663.7478 | -3.23 | 0 | 1 | 4 | 1Score > 19 indicates identity |
FGDNLQAWLEQNAR + 3 Deamidated (NQ) | |
| 846.3846 | 3381.5092 | 3381.5713 | -18.3 | 1 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
IGNMLLGGLVYPLTCQPQDMLQAMEENRR + 3 Deamidated (NQ); 2 Oxidation (M) |
Not what you expected? Try
the select summary.