| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | test |
| MS data file | : | PRT1346_ENIGMA_14.mgf |
| Database | : | Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues) |
| Timestamp | : | 4 Dec 2025 at 15:28:39 GMT |
Not what you expected? Try
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | |
| Variable modifications | : | |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 7,621 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 | 2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | ||||
| 6.2e-007 | 1 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | ||||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle (
) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 522.2372 | 1563.6899 | 1563.7160 | -16.7 | 0 | 1 | 3.7 | 1Score > 19 indicates identity |
NLMDAIELEQMPK + Deamidated (NQ); 2 Oxidation (M) | |
| 724.8293 | 2895.2883 | 2895.3457 | -19.8 | 1 | 1 | 2.9 | 1Score > 18 indicates identity |
YSNDLPQAEMTARELAYNAPGNQGLR + Deamidated (NQ); Oxidation (M) | |
| 832.8785 | 3327.4848 | 3327.4482 | 11.0 | 1 | 1 | 3.6 | 1Score > 19 indicates identity |
EQDKLWCGISDGAIDVVATDHCTFSMAQR + 2 Deamidated (NQ); Oxidation (M) | |
| 522.2372 | 2084.9199 | 2084.9592 | -18.9 | 0 | 1 | 3.7 | 1Score > 19 indicates identity |
ESTTLYNFLGSHNPYWR + Deamidated (NQ) | |
| 549.2496 | 1096.4846 | 1096.4753 | 8.44 | 1 | 1 | 1 | 1Score > 20 indicates identityScore > 14 indicates homology |
GDARMMASSR + Oxidation (M) | |
| 643.7925 | 1285.5705 | 1285.5609 | 7.53 | 0 | 1 | 3 | 1Score > 18 indicates identity |
DNGAEYTMTLR + Oxidation (M) | |
| 657.2986 | 1312.5827 | 1312.6090 | -20.0 | 1 | 1 | 1 | 1Score > 21 indicates identityScore > 14 indicates homology |
WQMMLSKSMR + Oxidation (M) | |
| 724.8293 | 2895.2883 | 2895.2778 | 3.61 | 1 | 1 | 2.9 | 1Score > 18 indicates identity |
QPPMQQFIDNMMDASDHPKFAQYR + Deamidated (NQ) | |
| 927.4214 | 3705.6567 | 3705.6704 | -3.70 | 1 | 1 | 1 | 1Score > 21 indicates identityScore > 14 indicates homology |
DMPYLEQMVQGVKAMGLEACMTLGTLSESQAQR + 2 Deamidated (NQ); 2 Oxidation (M) | |
| 940.9276 | 3759.6811 | 3759.6790 | 0.56 | 1 | 1 | 3.6 | 1Score > 19 indicates identity |
VESTNSYVLCHLFDQPTHTSAMFICDRCGAVK + Deamidated (NQ); Oxidation (M) | |
| 576.2618 | 1150.5091 | 1150.5288 | -17.1 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 14 indicates homology |
QTQLTEEMR + Oxidation (M) | |
| 886.9030 | 3543.5830 | 3543.5453 | 10.6 | 0 | 1 | 3.6 | 1Score > 19 indicates identity |
QFGIDAWQMEGADNYGNVQFTGYYTPVIQAR + 5 Deamidated (NQ) | |
| 900.4092 | 1798.8038 | 1798.8155 | -6.52 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 14 indicates homology |
ASAEEIQDHQCEILR + Deamidated (NQ) | |
| 616.7802 | 1231.5459 | 1231.5503 | -3.59 | 0 | 1 | 2.8 | 1Score > 18 indicates identity |
IGMENGTTHQK + Deamidated (NQ); Oxidation (M) | |
| 805.8662 | 3219.4357 | 3219.4666 | -9.58 | 1 | 1 | 3.1 | 1Score > 19 indicates identity |
TNVDLQIRIMNDENFQHGGTNIHYLEK + 5 Deamidated (NQ); Oxidation (M) | |
| 711.3232 | 1420.6319 | 1420.6075 | 17.2 | 0 | 1 | 1 | 1Score > 21 indicates identityScore > 14 indicates homology |
MDNMQTEAQPTR | |
| 886.9030 | 3543.5830 | 3543.6418 | -16.6 | 1 | 1 | 3.6 | 1Score > 19 indicates identity |
MQKEQLSALMDGETLDSELLNELAHNPEMQK + 2 Deamidated (NQ) | |
| 522.2372 | 2084.9199 | 2084.9176 | 1.07 | 1 | 1 | 3.8 | 1Score > 19 indicates identity |
MTTLNCSGQCRLQAVEAK + 3 Deamidated (NQ); Oxidation (M) | |
| 670.8048 | 1339.5951 | 1339.6004 | -4.02 | 0 | 1 | 3.6 | 1Score > 19 indicates identity |
ESGGDFASVTGGTR | |
| 738.3355 | 2949.3129 | 2949.3208 | -2.66 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 14 indicates homology |
EWAQAGFLNIVGGCCGTTPQHIAAMSR + 2 Deamidated (NQ); Oxidation (M) | |
| 765.3478 | 2293.0215 | 2292.9892 | 14.1 | 1 | 1 | 1 | 1Score > 21 indicates identityScore > 14 indicates homology |
MTNMQGESRFLHPLNHYNS + 2 Deamidated (NQ); Oxidation (M) | |
| 792.3600 | 1582.7055 | 1582.6821 | 14.8 | 0 | 1 | 1 | 1Score > 21 indicates identityScore > 14 indicates homology |
CDLQNYGDSATLPK + 2 Deamidated (NQ) | |
| 846.3846 | 1690.7546 | 1690.7475 | 4.23 | 0 | 1 | 0.89 | 1Score > 20 indicates identityScore > 13 indicates homology |
ESSVPFSYYDNQQK | |
| 900.4092 | 2698.2057 | 2698.2180 | -4.56 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 14 indicates homology |
ASENMTPQDYIGHHLNNLQLDLR + 4 Deamidated (NQ); Oxidation (M) | |
| 954.4337 | 2860.2793 | 2860.2726 | 2.34 | 1 | 1 | 0.99 | 1Score > 21 indicates identityScore > 14 indicates homology |
MMTCQISDGSGILTMRFFNFSAAMK + Deamidated (NQ); Oxidation (M) | |
| 414.1881 | 1239.5426 | 1239.5661 | -19.0 | 0 | 1 | 3.7 | 1Score > 19 indicates identity |
SPMELMTMLR + 2 Oxidation (M) | |
| 792.3600 | 1582.7055 | 1582.7263 | -13.1 | 0 | 1 | 1 | 1Score > 21 indicates identityScore > 14 indicates homology |
DGQVYNIAFENGEK | |
| 873.3969 | 1744.7793 | 1744.7865 | -4.17 | 0 | 1 | 1 | 1Score > 22 indicates identityScore > 14 indicates homology |
FAAATDDEMFELLEK + Oxidation (M) | |
| 913.9153 | 1825.8160 | 1825.7900 | 14.2 | 0 | 1 | 3.5 | 1Score > 19 indicates identity |
NGYNSAALNGDMNQALR + 2 Deamidated (NQ); Oxidation (M) | |
| 508.7311 | 2030.8955 | 2030.9044 | -4.38 | 0 | 1 | 2.1 | 1Score > 17 indicates identity |
DNGFFPNFSIAQNMAISR + 3 Deamidated (NQ) | |
| 576.2618 | 2301.0183 | 2300.9751 | 18.7 | 0 | 1 | 0.86 | 1Score > 20 indicates identityScore > 13 indicates homology |
MSAIENFDAHTPMMQQYLR + 3 Deamidated (NQ); Oxidation (M) | |
| 657.2986 | 1312.5827 | 1312.5830 | -0.17 | 0 | 1 | 0.96 | 1Score > 21 indicates identityScore > 13 indicates homology |
NHCEILQGNAR + 2 Deamidated (NQ) | |
| 684.3109 | 1366.6073 | 1366.6221 | -10.8 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 14 indicates homology |
LANAAITDMQMR + Deamidated (NQ); 2 Oxidation (M) | |
| 954.4337 | 1906.8529 | 1906.8690 | -8.46 | 1 | 1 | 1 | 1Score > 21 indicates identityScore > 14 indicates homology |
LSAEDNARVNVAMNQTR + 3 Deamidated (NQ); Oxidation (M) | |
| 400.6820 | 1598.6989 | 1598.7186 | -12.3 | 1 | 1 | 1.8 | 1Score > 16 indicates identity |
GGQHSGGNFKNDPQR + Deamidated (NQ) | |
| 441.2004 | 1760.7727 | 1760.7433 | 16.7 | 1 | 1 | 0.89 | 1Score > 20 indicates identityScore > 13 indicates homology |
YSWKVSGMDCAACAR | |
| 441.2004 | 1320.5795 | 1320.6027 | -17.5 | 1 | 1 | 1 | 1Score > 20 indicates identityScore > 14 indicates homology |
MAQQRQSGMER | |
| 454.7066 | 907.3986 | 907.3817 | 18.6 | 1 | 1 | 2.5 | 1Score > 17 indicates identity |
ENMGRER + Deamidated (NQ); Oxidation (M) | |
| 711.3232 | 2841.2639 | 2841.3028 | -13.7 | 1 | 1 | 0.97 | 1Score > 21 indicates identityScore > 13 indicates homology |
NVSLMPGVRYDYDNYLSNHNISPR + 2 Deamidated (NQ); Oxidation (M) | |
| 738.3355 | 2949.3129 | 2949.3499 | -12.5 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 14 indicates homology |
MNNAFMMHASTSPFYPLFAALNINAK + Deamidated (NQ); 3 Oxidation (M) | |
| 846.3846 | 3381.5092 | 3381.5291 | -5.87 | 0 | 1 | 0.92 | 1Score > 20 indicates identityScore > 13 indicates homology |
DGCIAIACPITGDWVAMTNHTWAFSIAEMK + Oxidation (M) | |
| 900.4092 | 1798.8038 | 1798.8151 | -6.27 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 14 indicates homology |
VMQVSAMADQMLLDSK + Deamidated (NQ); 2 Oxidation (M) | |
| 427.6943 | 853.3741 | 853.3600 | 16.5 | 0 | 1 | 1.7 | 1Score > 16 indicates identity |
MTSSAGQR + Deamidated (NQ); Oxidation (M) | |
| 589.7679 | 1177.5213 | 1177.5332 | -10.1 | 1 | 1 | 3.4 | 1Score > 19 indicates identity |
ANNPTSRMMR + Deamidated (NQ) | |
| 441.2004 | 1320.5795 | 1320.5768 | 2.02 | 1 | 1 | 1 | 1Score > 20 indicates identityScore > 14 indicates homology |
KEWVADCQQR + 2 Deamidated (NQ) | |
| 508.7311 | 2030.8955 | 2030.9037 | -4.05 | 1 | 1 | 2.2 | 1Score > 17 indicates identity |
HGNSEMQKINQTSAMPEK + 2 Deamidated (NQ) | |
| 535.7434 | 2138.9445 | 2138.9348 | 4.57 | 0 | 1 | 2.6 | 1Score > 18 indicates identity |
LSESENVDDVSVMMGTPANK + Deamidated (NQ); Oxidation (M) | |
| 792.3600 | 1582.7055 | 1582.7032 | 1.46 | 0 | 1 | 1 | 1Score > 21 indicates identityScore > 14 indicates homology |
NDSTIGVTVASMEDK + Deamidated (NQ); Oxidation (M) | |
| 819.3723 | 3273.4602 | 3273.4884 | -8.64 | 0 | 1 | 0.9 | 1Score > 21 indicates identityScore > 13 indicates homology |
IMVHGGEFVSLVVTGNNFDEASAAAHEDAER + 2 Deamidated (NQ) | |
| 980.1954 | 2937.5645 | 2937.5117 | 18.0 | 0 | 1 | 2.9 | 1Score > 18 indicates identity |
AATIAHVQQNAAVLEVELSSAELAMLDK + Oxidation (M) | |
| 427.6943 | 853.3741 | 853.3786 | -5.31 | 0 | 1 | 1.7 | 1Score > 16 indicates identity |
AINMMSR + 2 Oxidation (M) | |
| 454.7066 | 1814.7972 | 1814.8100 | -7.07 | 0 | 1 | 2.5 | 1Score > 17 indicates identity |
VMQVSAMADQMLLDSK + Deamidated (NQ); 3 Oxidation (M) | |
| 535.7434 | 2138.9445 | 2138.9572 | -5.92 | 1 | 1 | 2.6 | 1Score > 18 indicates identity |
SMNDALITRVTGEENGQMR + 2 Deamidated (NQ); Oxidation (M) | |
| 697.8171 | 2787.2392 | 2787.2392 | -0.013 | 1 | 1 | 3.8 | 1Score > 19 indicates identity |
TIVSDGKPQTDNDTGMISYKDANGNK + 3 Deamidated (NQ); Oxidation (M) | |
| 927.4214 | 2779.2425 | 2779.2476 | -1.83 | 1 | 1 | 1 | 1Score > 21 indicates identityScore > 14 indicates homology |
KQTNHAMINNMDFEGNNSCLVVSR + Deamidated (NQ) | |
| 387.1759 | 1544.6744 | 1544.6889 | -9.41 | 0 | 1 | 1.9 | 1Score > 16 indicates identity |
QAGCTLHEVGTTNR + 2 Deamidated (NQ) | |
| 468.2127 | 934.4109 | 934.4066 | 4.58 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 14 indicates homology |
SVESEPCK | |
| 711.3232 | 2130.9479 | 2130.9649 | -7.96 | 1 | 1 | 0.89 | 1Score > 21 indicates identityScore > 13 indicates homology |
MMRYSIAAMQNHLDAGYK + 2 Oxidation (M) | |
| 846.3846 | 2536.1319 | 2536.1110 | 8.23 | 1 | 1 | 0.82 | 1Score > 20 indicates identityScore > 13 indicates homology |
MAQQSPYSAAMAEQRHQEWLR + 3 Deamidated (NQ); Oxidation (M) | |
| 859.8907 | 3435.5339 | 3435.5962 | -18.1 | 1 | 1 | 3 | 1Score > 18 indicates identity |
NNGFDGTDAVLEFNKPEQVKHIAMLEEMNK + 2 Deamidated (NQ); Oxidation (M) | |
| 873.3969 | 2617.1689 | 2617.1754 | -2.49 | 1 | 1 | 1 | 1Score > 22 indicates identityScore > 14 indicates homology |
NYFNQQPAYVLREDGSQGEAMAK + 2 Deamidated (NQ) | |
| 886.9030 | 3543.5830 | 3543.5897 | -1.90 | 0 | 1 | 3.7 | 1Score > 19 indicates identity |
IIFLHMMGSHPNPCDSLNSPPNNYLEQYPR + 3 Deamidated (NQ) | |
| 940.9276 | 3759.6811 | 3759.7403 | -15.7 | 0 | 1 | 3.7 | 1Score > 19 indicates identity |
YAELFGGAQQWGQQVYAIVQNTDQAQAVMPYGPK + 4 Deamidated (NQ) | |
| 589.7679 | 2355.0427 | 2355.0796 | -15.7 | 1 | 1 | 3.4 | 1Score > 19 indicates identity |
NFVLMQQKMAAGENPAAEMIK + 3 Deamidated (NQ); 2 Oxidation (M) | |
| 670.8048 | 2679.1901 | 2679.2308 | -15.2 | 1 | 1 | 3.7 | 1Score > 19 indicates identity |
ELGATLSYNMRLGNGMEHEPWLK + 2 Deamidated (NQ); 2 Oxidation (M) | |
| 778.8539 | 3111.3864 | 3111.4057 | -6.20 | 1 | 1 | 3.1 | 1Score > 18 indicates identity |
NLAQQKSNDPEQVYAYGLYLSGHDQDR + 3 Deamidated (NQ) | |
| 414.1881 | 1652.7235 | 1652.7069 | 10.0 | 1 | 1 | 3.7 | 1Score > 19 indicates identity |
RMGELMAESHASMR + 3 Oxidation (M) | |
| 427.6943 | 1706.7481 | 1706.7716 | -13.7 | 1 | 1 | 1.7 | 1Score > 16 indicates identity |
MDSNNQIEPCLSRK + Oxidation (M) | |
| 630.2864 | 1258.5582 | 1258.5367 | 17.1 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
QWNNEPAGWR + 2 Deamidated (NQ) | |
| 400.6820 | 1598.6989 | 1598.7186 | -12.3 | 1 | 1 | 1.8 | 1Score > 16 indicates identity |
GGQHSGGNFKNDPQR + Deamidated (NQ) | |
| 481.7188 | 961.4231 | 961.4141 | 9.40 | 0 | 1 | 2.8 | 1Score > 18 indicates identity |
NGWENNVK + 2 Deamidated (NQ) | |
| 535.7434 | 2138.9445 | 2138.9828 | -17.9 | 0 | 1 | 2.6 | 1Score > 18 indicates identity |
GSAVNQNGAAAGATVPNGPAQER + 3 Deamidated (NQ) | |
| 792.3600 | 2374.0583 | 2374.0127 | 19.2 | 0 | 1 | 0.83 | 1Score > 21 indicates identityScore > 13 indicates homology |
NINVMQESSVGPALSMNFDMR + 3 Deamidated (NQ); 2 Oxidation (M) | |
| 900.4092 | 3597.6076 | 3597.5949 | 3.53 | 1 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
STGEAMELMEQLASKLPTGVGYDWTGMSYQER + Deamidated (NQ); 2 Oxidation (M) | |
| 643.7925 | 1285.5705 | 1285.5826 | -9.42 | 0 | 1 | 3.2 | 1Score > 18 indicates identity |
ADGAYLYDVDGK | |
| 765.3478 | 3057.3620 | 3057.3702 | -2.68 | 1 | 1 | 0.88 | 1Score > 21 indicates identityScore > 13 indicates homology |
MKAFPETFLWGGATAANQVEGAWQEDGK + 3 Deamidated (NQ); Oxidation (M) | |
| 778.8539 | 3111.3864 | 3111.4463 | -19.3 | 1 | 1 | 3.1 | 1Score > 18 indicates identity |
SAVNNVPYAVGINNHMGSKMTSNLFGMQK + 3 Deamidated (NQ) | |
| 805.8662 | 3219.4357 | 3219.4666 | -9.58 | 1 | 1 | 3.2 | 1Score > 19 indicates identity |
TNVDLQIRIMNDENFQHGGTNIHYLEK + 5 Deamidated (NQ); Oxidation (M) | |
| 832.8785 | 3327.4848 | 3327.4482 | 11.0 | 1 | 1 | 3.8 | 1Score > 19 indicates identity |
EQDKLWCGISDGAIDVVATDHCTFSMAQR + 2 Deamidated (NQ); Oxidation (M) | |
| 846.3846 | 1690.7546 | 1690.7403 | 8.47 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
SEMGDLAQSVSHMQR + Oxidation (M) | |
| 913.9153 | 3651.6320 | 3651.6920 | -16.4 | 1 | 1 | 3.6 | 1Score > 19 indicates identity |
NVMLGGGDNALMLPEQASNIRLQSSETPQEIFR + 5 Deamidated (NQ); 2 Oxidation (M) | |
| 468.2127 | 934.4109 | 934.4178 | -7.41 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
NAALNEMR + Deamidated (NQ); Oxidation (M) | |
| 576.2618 | 1150.5091 | 1150.4964 | 11.0 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
MNLHEYQAK + 2 Deamidated (NQ); Oxidation (M) | |
| 603.2741 | 1806.8005 | 1806.8240 | -13.0 | 1 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
EEARGEQNNMVMILR + 2 Deamidated (NQ); Oxidation (M) | |
| 603.2741 | 1806.8005 | 1806.7989 | 0.91 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
QQMLPNTNGGMLNSNR + Deamidated (NQ); 2 Oxidation (M) | |
| 697.8171 | 2787.2392 | 2787.2408 | -0.57 | 0 | 1 | 3.8 | 1Score > 19 indicates identity |
GFMVLGFPCNQFLEQEPGSDEEIK + Deamidated (NQ); Oxidation (M) | |
| 414.1881 | 1652.7235 | 1652.7174 | 3.66 | 0 | 1 | 3.8 | 1Score > 19 indicates identity |
FAPTSSPEQMAMAQR + 2 Deamidated (NQ) | |
| 441.2004 | 1760.7727 | 1760.7940 | -12.1 | 1 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
EYTWANLMERNYR + Oxidation (M) | |
| 495.2250 | 1976.8708 | 1976.8682 | 1.33 | 0 | 1 | 0.93 | 1Score > 20 indicates identityScore > 13 indicates homology |
YEMLDAIQPQMATMFR + Deamidated (NQ); 2 Oxidation (M) | |
| 738.3355 | 2211.9847 | 2211.9421 | 19.3 | 1 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
AQAQSNVTQMMRMFNFMK + 2 Deamidated (NQ); 3 Oxidation (M) | |
| 913.9153 | 3651.6320 | 3651.6379 | -1.60 | 1 | 1 | 3.7 | 1Score > 19 indicates identity |
QVVIDGETCLLDILDTAGQEEYSAMRDQYMR + Deamidated (NQ); 2 Oxidation (M) | |
| 522.2372 | 2084.9199 | 2084.9118 | 3.88 | 0 | 1 | 3.9 | 1Score > 19 indicates identity |
YQGYCDAMMLHNLSPLR + Deamidated (NQ); Oxidation (M) | |
| 589.7679 | 1177.5213 | 1177.5107 | 9.02 | 0 | 1 | 3.5 | 1Score > 19 indicates identity |
MQQSIDPAMR + 2 Deamidated (NQ) | |
| 819.3723 | 3273.4602 | 3273.4334 | 8.16 | 0 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
DEPGTEISAGWGSNSYQNYDVSTQQQLGDK | |
| 481.7188 | 1922.8463 | 1922.8778 | -16.4 | 0 | 1 | 2.8 | 1Score > 18 indicates identity |
SANMTLEQLESLNAEQK + 2 Deamidated (NQ); Oxidation (M) | |
| 535.7434 | 2138.9445 | 2138.9395 | 2.37 | 1 | 1 | 2.6 | 1Score > 18 indicates identity |
GQASLDAGCDMILVCNNRK + 2 Deamidated (NQ); Oxidation (M) | |
| 576.2618 | 2301.0183 | 2301.0484 | -13.1 | 1 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
TGENQYRVWPNEMPADLHK + Deamidated (NQ); Oxidation (M) | |
| 562.7557 | 2246.9936 | 2246.9823 | 5.01 | 1 | 1 | 3 | 1Score > 18 indicates identity |
GITNSQAEWMKYGEQMSTGK + 2 Deamidated (NQ) | |
| 819.3723 | 2455.0951 | 2455.1393 | -18.0 | 1 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
NISKNMQNTMGQVTTSAEQMLK + 2 Deamidated (NQ) | |
| 427.6943 | 1706.7481 | 1706.7689 | -12.2 | 0 | 1 | 1.7 | 1Score > 16 indicates identity |
EFWNVVNWDEAAAR + Deamidated (NQ) |
Not what you expected? Try
the select summary.