MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 4 Dec 2025 at 15:28:39 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1401–1500 (out of 7566)


Page: Previous 1 10 11 12 13 14 15 16 17 18 19 20  76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
1790 522.2372 1563.6899 1563.7160 -16.7 0 1 3.7 +1Score > 19 indicates identity NLMDAIELEQMPK + Deamidated (NQ); 2 Oxidation (M)
4254 724.8293 2895.2883 2895.3457 -19.8 1 1 2.9 +1Score > 18 indicates identity YSNDLPQAEMTARELAYNAPGNQGLR + Deamidated (NQ); Oxidation (M)
5735 832.8785 3327.4848 3327.4482 11.0 1 1 3.6 +1Score > 19 indicates identity EQDKLWCGISDGAIDVVATDHCTFSMAQR + 2 Deamidated (NQ); Oxidation (M)
1759 522.2372 2084.9199 2084.9592 -18.9 0 1 3.7 +1Score > 19 indicates identity ESTTLYNFLGSHNPYWR + Deamidated (NQ)
2071 549.2496 1096.4846 1096.4753 8.44 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
GDARMMASSR + Oxidation (M)
3378 643.7925 1285.5705 1285.5609 7.53 0 1 3 +1Score > 18 indicates identity DNGAEYTMTLR + Oxidation (M)
3500 657.2986 1312.5827 1312.6090 -20.0 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
WQMMLSKSMR + Oxidation (M)
4253 724.8293 2895.2883 2895.2778 3.61 1 1 2.9 +1Score > 18 indicates identity QPPMQQFIDNMMDASDHPKFAQYR + Deamidated (NQ)
6795 927.4214 3705.6567 3705.6704 -3.70 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
DMPYLEQMVQGVKAMGLEACMTLGTLSESQAQR + 2 Deamidated (NQ); 2 Oxidation (M)
6957 940.9276 3759.6811 3759.6790 0.56 1 1 3.6 +1Score > 19 indicates identity VESTNSYVLCHLFDQPTHTSAMFICDRCGAVK + Deamidated (NQ); Oxidation (M)
2491 576.2618 1150.5091 1150.5288 -17.1 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
QTQLTEEMR + Oxidation (M)
6291 886.9030 3543.5830 3543.5453 10.6 0 1 3.6 +1Score > 19 indicates identity QFGIDAWQMEGADNYGNVQFTGYYTPVIQAR + 5 Deamidated (NQ)
6535 900.4092 1798.8038 1798.8155 -6.52 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
ASAEEIQDHQCEILR + Deamidated (NQ)
2915 616.7802 1231.5459 1231.5503 -3.59 0 1 2.8 +1Score > 18 indicates identity IGMENGTTHQK + Deamidated (NQ); Oxidation (M)
5290 805.8662 3219.4357 3219.4666 -9.58 1 1 3.1 +1Score > 19 indicates identity TNVDLQIRIMNDENFQHGGTNIHYLEK + 5 Deamidated (NQ); Oxidation (M)
4097 711.3232 1420.6319 1420.6075 17.2 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
MDNMQTEAQPTR
6279 886.9030 3543.5830 3543.6418 -16.6 1 1 3.6 +1Score > 19 indicates identity MQKEQLSALMDGETLDSELLNELAHNPEMQK + 2 Deamidated (NQ)
1811 522.2372 2084.9199 2084.9176 1.07 1 1 3.8 +1Score > 19 indicates identity MTTLNCSGQCRLQAVEAK + 3 Deamidated (NQ); Oxidation (M)
3592 670.8048 1339.5951 1339.6004 -4.02 0 1 3.6 +1Score > 19 indicates identity ESGGDFASVTGGTR
4523 738.3355 2949.3129 2949.3208 -2.66 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
EWAQAGFLNIVGGCCGTTPQHIAAMSR + 2 Deamidated (NQ); Oxidation (M)
4882 765.3478 2293.0215 2292.9892 14.1 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
MTNMQGESRFLHPLNHYNS + 2 Deamidated (NQ); Oxidation (M)
5172 792.3600 1582.7055 1582.6821 14.8 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
CDLQNYGDSATLPK + 2 Deamidated (NQ)
5835 846.3846 1690.7546 1690.7475 4.23 0 1 0.89 +1Score > 20 indicates identity
Score > 13 indicates homology
ESSVPFSYYDNQQK
6504 900.4092 2698.2057 2698.2180 -4.56 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
ASENMTPQDYIGHHLNNLQLDLR + 4 Deamidated (NQ); Oxidation (M)
7155 954.4337 2860.2793 2860.2726 2.34 1 1 0.99 +1Score > 21 indicates identity
Score > 14 indicates homology
MMTCQISDGSGILTMRFFNFSAAMK + Deamidated (NQ); Oxidation (M)
486 414.1881 1239.5426 1239.5661 -19.0 0 1 3.7 +1Score > 19 indicates identity SPMELMTMLR + 2 Oxidation (M)
5123 792.3600 1582.7055 1582.7263 -13.1 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
DGQVYNIAFENGEK
6118 873.3969 1744.7793 1744.7865 -4.17 0 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology
FAAATDDEMFELLEK + Oxidation (M)
6676 913.9153 1825.8160 1825.7900 14.2 0 1 3.5 +1Score > 19 indicates identity NGYNSAALNGDMNQALR + 2 Deamidated (NQ); Oxidation (M)
1640 508.7311 2030.8955 2030.9044 -4.38 0 1 2.1 +1Score > 17 indicates identity DNGFFPNFSIAQNMAISR + 3 Deamidated (NQ)
2442 576.2618 2301.0183 2300.9751 18.7 0 1 0.86 +1Score > 20 indicates identity
Score > 13 indicates homology
MSAIENFDAHTPMMQQYLR + 3 Deamidated (NQ); Oxidation (M)
3476 657.2986 1312.5827 1312.5830 -0.17 0 1 0.96 +1Score > 21 indicates identity
Score > 13 indicates homology
NHCEILQGNAR + 2 Deamidated (NQ)
3795 684.3109 1366.6073 1366.6221 -10.8 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
LANAAITDMQMR + Deamidated (NQ); 2 Oxidation (M)
7163 954.4337 1906.8529 1906.8690 -8.46 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
LSAEDNARVNVAMNQTR + 3 Deamidated (NQ); Oxidation (M)
223 400.6820 1598.6989 1598.7186 -12.3 1 1 1.8 +1Score > 16 indicates identity GGQHSGGNFKNDPQR + Deamidated (NQ)
710 441.2004 1760.7727 1760.7433 16.7 1 1 0.89 +1Score > 20 indicates identity
Score > 13 indicates homology
YSWKVSGMDCAACAR
767 441.2004 1320.5795 1320.6027 -17.5 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
MAQQRQSGMER
936 454.7066 907.3986 907.3817 18.6 1 1 2.5 +1Score > 17 indicates identity ENMGRER + Deamidated (NQ); Oxidation (M)
4095 711.3232 2841.2639 2841.3028 -13.7 1 1 0.97 +1Score > 21 indicates identity
Score > 13 indicates homology
NVSLMPGVRYDYDNYLSNHNISPR + 2 Deamidated (NQ); Oxidation (M)
4477 738.3355 2949.3129 2949.3499 -12.5 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
MNNAFMMHASTSPFYPLFAALNINAK + Deamidated (NQ); 3 Oxidation (M)
5802 846.3846 3381.5092 3381.5291 -5.87 0 1 0.92 +1Score > 20 indicates identity
Score > 13 indicates homology
DGCIAIACPITGDWVAMTNHTWAFSIAEMK + Oxidation (M)
6539 900.4092 1798.8038 1798.8151 -6.27 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
VMQVSAMADQMLLDSK + Deamidated (NQ); 2 Oxidation (M)
527 427.6943 853.3741 853.3600 16.5 0 1 1.7 +1Score > 16 indicates identity MTSSAGQR + Deamidated (NQ); Oxidation (M)
2693 589.7679 1177.5213 1177.5332 -10.1 1 1 3.4 +1Score > 19 indicates identity ANNPTSRMMR + Deamidated (NQ)
698 441.2004 1320.5795 1320.5768 2.02 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
KEWVADCQQR + 2 Deamidated (NQ)
1566 508.7311 2030.8955 2030.9037 -4.05 1 1 2.2 +1Score > 17 indicates identity HGNSEMQKINQTSAMPEK + 2 Deamidated (NQ)
1898 535.7434 2138.9445 2138.9348 4.57 0 1 2.6 +1Score > 18 indicates identity LSESENVDDVSVMMGTPANK + Deamidated (NQ); Oxidation (M)
5215 792.3600 1582.7055 1582.7032 1.46 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
NDSTIGVTVASMEDK + Deamidated (NQ); Oxidation (M)
5488 819.3723 3273.4602 3273.4884 -8.64 0 1 0.9 +1Score > 21 indicates identity
Score > 13 indicates homology
IMVHGGEFVSLVVTGNNFDEASAAAHEDAER + 2 Deamidated (NQ)
7488 980.1954 2937.5645 2937.5117 18.0 0 1 2.9 +1Score > 18 indicates identity AATIAHVQQNAAVLEVELSSAELAMLDK + Oxidation (M)
613 427.6943 853.3741 853.3786 -5.31 0 1 1.7 +1Score > 16 indicates identity AINMMSR + 2 Oxidation (M)
889 454.7066 1814.7972 1814.8100 -7.07 0 1 2.5 +1Score > 17 indicates identity VMQVSAMADQMLLDSK + Deamidated (NQ); 3 Oxidation (M)
2015 535.7434 2138.9445 2138.9572 -5.92 1 1 2.6 +1Score > 18 indicates identity SMNDALITRVTGEENGQMR + 2 Deamidated (NQ); Oxidation (M)
4028 697.8171 2787.2392 2787.2392 -0.013 1 1 3.8 +1Score > 19 indicates identity TIVSDGKPQTDNDTGMISYKDANGNK + 3 Deamidated (NQ); Oxidation (M)
6829 927.4214 2779.2425 2779.2476 -1.83 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
KQTNHAMINNMDFEGNNSCLVVSR + Deamidated (NQ)
43 387.1759 1544.6744 1544.6889 -9.41 0 1 1.9 +1Score > 16 indicates identity QAGCTLHEVGTTNR + 2 Deamidated (NQ)
1049 468.2127 934.4109 934.4066 4.58 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
SVESEPCK
4137 711.3232 2130.9479 2130.9649 -7.96 1 1 0.89 +1Score > 21 indicates identity
Score > 13 indicates homology
MMRYSIAAMQNHLDAGYK + 2 Oxidation (M)
5796 846.3846 2536.1319 2536.1110 8.23 1 1 0.82 +1Score > 20 indicates identity
Score > 13 indicates homology
MAQQSPYSAAMAEQRHQEWLR + 3 Deamidated (NQ); Oxidation (M)
5947 859.8907 3435.5339 3435.5962 -18.1 1 1 3 +1Score > 18 indicates identity NNGFDGTDAVLEFNKPEQVKHIAMLEEMNK + 2 Deamidated (NQ); Oxidation (M)
6150 873.3969 2617.1689 2617.1754 -2.49 1 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology
NYFNQQPAYVLREDGSQGEAMAK + 2 Deamidated (NQ)
6298 886.9030 3543.5830 3543.5897 -1.90 0 1 3.7 +1Score > 19 indicates identity IIFLHMMGSHPNPCDSLNSPPNNYLEQYPR + 3 Deamidated (NQ)
7062 940.9276 3759.6811 3759.7403 -15.7 0 1 3.7 +1Score > 19 indicates identity YAELFGGAQQWGQQVYAIVQNTDQAQAVMPYGPK + 4 Deamidated (NQ)
2667 589.7679 2355.0427 2355.0796 -15.7 1 1 3.4 +1Score > 19 indicates identity NFVLMQQKMAAGENPAAEMIK + 3 Deamidated (NQ); 2 Oxidation (M)
3629 670.8048 2679.1901 2679.2308 -15.2 1 1 3.7 +1Score > 19 indicates identity ELGATLSYNMRLGNGMEHEPWLK + 2 Deamidated (NQ); 2 Oxidation (M)
4945 778.8539 3111.3864 3111.4057 -6.20 1 1 3.1 +1Score > 18 indicates identity NLAQQKSNDPEQVYAYGLYLSGHDQDR + 3 Deamidated (NQ)
433 414.1881 1652.7235 1652.7069 10.0 1 1 3.7 +1Score > 19 indicates identity RMGELMAESHASMR + 3 Oxidation (M)
569 427.6943 1706.7481 1706.7716 -13.7 1 1 1.7 +1Score > 16 indicates identity MDSNNQIEPCLSRK + Oxidation (M)
3150 630.2864 1258.5582 1258.5367 17.1 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
QWNNEPAGWR + 2 Deamidated (NQ)
254 400.6820 1598.6989 1598.7186 -12.3 1 1 1.8 +1Score > 16 indicates identity GGQHSGGNFKNDPQR + Deamidated (NQ)
1307 481.7188 961.4231 961.4141 9.40 0 1 2.8 +1Score > 18 indicates identity NGWENNVK + 2 Deamidated (NQ)
1910 535.7434 2138.9445 2138.9828 -17.9 0 1 2.6 +1Score > 18 indicates identity GSAVNQNGAAAGATVPNGPAQER + 3 Deamidated (NQ)
5137 792.3600 2374.0583 2374.0127 19.2 0 1 0.83 +1Score > 21 indicates identity
Score > 13 indicates homology
NINVMQESSVGPALSMNFDMR + 3 Deamidated (NQ); 2 Oxidation (M)
6512 900.4092 3597.6076 3597.5949 3.53 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
STGEAMELMEQLASKLPTGVGYDWTGMSYQER + Deamidated (NQ); 2 Oxidation (M)
3349 643.7925 1285.5705 1285.5826 -9.42 0 1 3.2 +1Score > 18 indicates identity ADGAYLYDVDGK
4794 765.3478 3057.3620 3057.3702 -2.68 1 1 0.88 +1Score > 21 indicates identity
Score > 13 indicates homology
MKAFPETFLWGGATAANQVEGAWQEDGK + 3 Deamidated (NQ); Oxidation (M)
5021 778.8539 3111.3864 3111.4463 -19.3 1 1 3.1 +1Score > 18 indicates identity SAVNNVPYAVGINNHMGSKMTSNLFGMQK + 3 Deamidated (NQ)
5303 805.8662 3219.4357 3219.4666 -9.58 1 1 3.2 +1Score > 19 indicates identity TNVDLQIRIMNDENFQHGGTNIHYLEK + 5 Deamidated (NQ); Oxidation (M)
5725 832.8785 3327.4848 3327.4482 11.0 1 1 3.8 +1Score > 19 indicates identity EQDKLWCGISDGAIDVVATDHCTFSMAQR + 2 Deamidated (NQ); Oxidation (M)
5806 846.3846 1690.7546 1690.7403 8.47 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
SEMGDLAQSVSHMQR + Oxidation (M)
6716 913.9153 3651.6320 3651.6920 -16.4 1 1 3.6 +1Score > 19 indicates identity NVMLGGGDNALMLPEQASNIRLQSSETPQEIFR + 5 Deamidated (NQ); 2 Oxidation (M)
1175 468.2127 934.4109 934.4178 -7.41 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
NAALNEMR + Deamidated (NQ); Oxidation (M)
2527 576.2618 1150.5091 1150.4964 11.0 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
MNLHEYQAK + 2 Deamidated (NQ); Oxidation (M)
2785 603.2741 1806.8005 1806.8240 -13.0 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
EEARGEQNNMVMILR + 2 Deamidated (NQ); Oxidation (M)
2856 603.2741 1806.8005 1806.7989 0.91 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
QQMLPNTNGGMLNSNR + Deamidated (NQ); 2 Oxidation (M)
3926 697.8171 2787.2392 2787.2408 -0.57 0 1 3.8 +1Score > 19 indicates identity GFMVLGFPCNQFLEQEPGSDEEIK + Deamidated (NQ); Oxidation (M)
477 414.1881 1652.7235 1652.7174 3.66 0 1 3.8 +1Score > 19 indicates identity FAPTSSPEQMAMAQR + 2 Deamidated (NQ)
820 441.2004 1760.7727 1760.7940 -12.1 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
EYTWANLMERNYR + Oxidation (M)
1438 495.2250 1976.8708 1976.8682 1.33 0 1 0.93 +1Score > 20 indicates identity
Score > 13 indicates homology
YEMLDAIQPQMATMFR + Deamidated (NQ); 2 Oxidation (M)
4434 738.3355 2211.9847 2211.9421 19.3 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
AQAQSNVTQMMRMFNFMK + 2 Deamidated (NQ); 3 Oxidation (M)
6638 913.9153 3651.6320 3651.6379 -1.60 1 1 3.7 +1Score > 19 indicates identity QVVIDGETCLLDILDTAGQEEYSAMRDQYMR + Deamidated (NQ); 2 Oxidation (M)
1825 522.2372 2084.9199 2084.9118 3.88 0 1 3.9 +1Score > 19 indicates identity YQGYCDAMMLHNLSPLR + Deamidated (NQ); Oxidation (M)
2595 589.7679 1177.5213 1177.5107 9.02 0 1 3.5 +1Score > 19 indicates identity MQQSIDPAMR + 2 Deamidated (NQ)
5485 819.3723 3273.4602 3273.4334 8.16 0 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
DEPGTEISAGWGSNSYQNYDVSTQQQLGDK
1221 481.7188 1922.8463 1922.8778 -16.4 0 1 2.8 +1Score > 18 indicates identity SANMTLEQLESLNAEQK + 2 Deamidated (NQ); Oxidation (M)
2025 535.7434 2138.9445 2138.9395 2.37 1 1 2.6 +1Score > 18 indicates identity GQASLDAGCDMILVCNNRK + 2 Deamidated (NQ); Oxidation (M)
2455 576.2618 2301.0183 2301.0484 -13.1 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
TGENQYRVWPNEMPADLHK + Deamidated (NQ); Oxidation (M)
2232 562.7557 2246.9936 2246.9823 5.01 1 1 3 +1Score > 18 indicates identity GITNSQAEWMKYGEQMSTGK + 2 Deamidated (NQ)
5460 819.3723 2455.0951 2455.1393 -18.0 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
NISKNMQNTMGQVTTSAEQMLK + 2 Deamidated (NQ)
565 427.6943 1706.7481 1706.7689 -12.2 0 1 1.7 +1Score > 16 indicates identity EFWNVVNWDEAAAR + Deamidated (NQ)
Page: Previous 1 10 11 12 13 14 15 16 17 18 19 20  76 Next 

Not what you expected? Try the select summary.