MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 4 Dec 2025 at 15:28:39 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1301–1400 (out of 7566)


Page: Previous 1 9 10 11 12 13 14 15 16 17 18 19  76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
5448 819.3723 2455.0951 2455.0970 -0.77 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
ELAAIFHQNTTMLMAGWGMQR + 2 Deamidated (NQ); 3 Oxidation (M)
7189 954.4337 1906.8529 1906.8883 -18.6 0 1 0.88 +1Score > 21 indicates identity
Score > 13 indicates homology
WSSQMINTLQIQFHR + 3 Deamidated (NQ); Oxidation (M)
733 441.2004 1760.7727 1760.8046 -18.2 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
MSHIQRETSCSRPR + Deamidated (NQ); Oxidation (M)
1780 522.2372 2084.9199 2084.9361 -7.77 0 1 3.5 +1Score > 19 indicates identity SDNCEDTPEAGYFAIAVVK
2820 603.2741 1204.5337 1204.5394 -4.76 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
DDPSMVADLSR
5812 846.3846 2536.1319 2536.0967 13.9 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
AAGLPAFTVMSCDNMPENGHVMR + 2 Oxidation (M)
6002 859.8907 3435.5339 3435.5818 -14.0 0 1 2.8 +1Score > 18 indicates identity DVNALMTAGQLINWGMPTLAAEMLNALDCQR + 3 Deamidated (NQ); Oxidation (M)
7297 967.9399 3867.7304 3867.7760 -11.8 0 1 3.4 +1Score > 19 indicates identity WVDSITEAWAMDNDAPKPYQAGTWGPVASVAMITR + 2 Deamidated (NQ); 2 Oxidation (M)
2684 589.7679 2355.0427 2355.0141 12.1 0 1 3.2 +1Score > 19 indicates identity NGQLNVLNCSTTMEMGVDTDR + Deamidated (NQ)
2702 589.7679 2355.0427 2355.0689 -11.1 1 1 3.2 +1Score > 19 indicates identity QGMHDLKVWPNVEADGSEPTK + 2 Deamidated (NQ); Oxidation (M)
3390 643.7925 2571.1411 2571.1767 -13.9 1 1 2.9 +1Score > 18 indicates identity MDSYVDLLQSHGGSMIMLAKGNR + Deamidated (NQ); 3 Oxidation (M)
5899 846.3846 1690.7546 1690.7832 -16.9 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
NGIANNMLLENGGSLR + 3 Deamidated (NQ); Oxidation (M)
6985 940.9276 3759.6811 3759.7356 -14.5 1 1 3.4 +1Score > 19 indicates identity GASTWAGGQSQDELMLKDECILVDADDNITGHVSK
649 427.6943 1706.7481 1706.7649 -9.84 0 1 1.6 +1Score > 16 indicates identity GSLGGGFSSGGFSGGSFSR
1812 522.2372 2084.9199 2084.9217 -0.87 0 1 3.5 +1Score > 19 indicates identity MWMAGQGTIQISDQMNIK + 2 Deamidated (NQ); 2 Oxidation (M)
2633 589.7679 2355.0427 2355.0615 -7.99 1 1 3.2 +1Score > 19 indicates identity IGGQTKHFLVHETQEEDDDR + 2 Deamidated (NQ)
2941 616.7802 2463.0917 2463.1190 -11.1 1 1 2.7 +1Score > 18 indicates identity RYAEEGADELVFYDITASSDGR
4605 751.8416 1501.6687 1501.6772 -5.68 0 1 3.2 +1Score > 19 indicates identity YHQWMNELPER
5613 832.8785 3327.4848 3327.5402 -16.7 1 1 3.4 +1Score > 19 indicates identity ARNIAMVFQNYALYPHMTVYDNMAFGLK + 2 Deamidated (NQ); 3 Oxidation (M)
2594 589.7679 2355.0427 2355.0834 -17.3 1 1 3.2 +1Score > 19 indicates identity QAESMLESMASRIDNYPELR + Oxidation (M)
3861 684.3109 1366.6073 1366.5857 15.8 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
EQQLEVMTGCR + Deamidated (NQ); Oxidation (M)
5603 832.8785 1663.7424 1663.7424 0.0030 1 1 3.4 +1Score > 19 indicates identity TIADKQADTNQEQAK + 4 Deamidated (NQ)
3478 657.2986 1312.5827 1312.5969 -10.8 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
QCSGVTFQSAVK + 2 Deamidated (NQ)
6624 913.9153 3651.6320 3651.5783 14.7 1 1 3.3 +1Score > 19 indicates identity AGDNGVTGGYSQFFGLKHQMSFDNGMNWNNALR + 3 Deamidated (NQ); Oxidation (M)
6797 927.4214 3705.6567 3705.6704 -3.70 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
DMPYLEQMVQGVKAMGLEACMTLGTLSESQAQR + 2 Deamidated (NQ); 2 Oxidation (M)
6153 873.3969 2617.1689 2617.2045 -13.6 1 1 0.82 +1Score > 22 indicates identity
Score > 13 indicates homology
VQNLSGNFRYSVTATPAGHHDESK + 3 Deamidated (NQ)
594 427.6943 853.3741 853.3600 16.5 0 1 1.6 +1Score > 16 indicates identity MTSSAGQR + Deamidated (NQ); Oxidation (M)
1383 495.2250 988.4354 988.4219 13.7 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
GNHEVMMR + Oxidation (M)
1766 522.2372 2084.9199 2084.9554 -17.0 1 1 3.6 +1Score > 19 indicates identity FQRLMSMQGQACQQLSR + Deamidated (NQ); Oxidation (M)
2876 603.2741 1204.5337 1204.5295 3.48 0 1 0.95 +1Score > 20 indicates identity
Score > 14 indicates homology
HACGYELAER
3585 670.8048 1339.5951 1339.6013 -4.65 0 1 3.4 +1Score > 19 indicates identity FCVQCEQTIR
4251 724.8293 2895.2883 2895.3459 -19.9 0 1 2.8 +1Score > 18 indicates identity DHLGIIPLYMGYDEHGQLYVASEMK + Deamidated (NQ); Oxidation (M)
1553 508.7311 1015.4477 1015.4458 1.91 0 1 2 +1Score > 17 indicates identity GNNQPDIQK + 3 Deamidated (NQ)
3761 684.3109 2049.9109 2049.9167 -2.82 1 1 0.75 +1Score > 20 indicates identity
Score > 13 indicates homology
KYPYLNNSGEANSTDTFK + 2 Deamidated (NQ)
4358 724.8293 2895.2883 2895.2868 0.51 1 1 2.8 +1Score > 18 indicates identity MNRVADDITVAPEYLEESNNQAWAR + 4 Deamidated (NQ)
6528 900.4092 2698.2057 2698.2180 -4.56 0 1 0.84 +1Score > 20 indicates identity
Score > 13 indicates homology
ASENMTPQDYIGHHLNNLQLDLR + 4 Deamidated (NQ); Oxidation (M)
3267 643.7925 1285.5705 1285.5795 -6.96 1 1 2.9 +1Score > 18 indicates identity IRDVCMEYGK + Oxidation (M)
5459 819.3723 2455.0951 2455.1393 -18.0 1 1 0.99 +1Score > 21 indicates identity
Score > 14 indicates homology
NISKNMQNTMGQVTTSAEQMLK + 2 Deamidated (NQ)
6958 940.9276 3759.6811 3759.7403 -15.7 0 1 3.5 +1Score > 19 indicates identity YAELFGGAQQWGQQVYAIVQNTDQAQAVMPYGPK + 4 Deamidated (NQ)
389 414.1881 1652.7235 1652.7069 10.0 1 1 3.5 +1Score > 19 indicates identity RMGELMAESHASMR + 3 Oxidation (M)
834 441.2004 880.3863 880.3960 -11.0 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
AMTTDAQK + Oxidation (M)
5614 832.8785 3327.4848 3327.5461 -18.4 1 1 3.5 +1Score > 19 indicates identity DYLHIDMAASYMVGDKLEDMQAAVAANVGTK + Deamidated (NQ)
6488 900.4092 2698.2057 2698.2591 -19.8 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
AIGAELACSRPVAENEKWMEHER + Oxidation (M)
358 414.1881 1652.7235 1652.7069 10.0 1 1 3.5 +1Score > 19 indicates identity RMGELMAESHASMR + 3 Oxidation (M)
443 414.1881 1652.7235 1652.7069 10.0 1 1 3.5 +1Score > 19 indicates identity RMGELMAESHASMR + 3 Oxidation (M)
827 441.2004 1760.7727 1760.7896 -9.60 1 1 0.86 +1Score > 20 indicates identity
Score > 13 indicates homology
FRTTTGDAMGMNMISK + Deamidated (NQ)
2087 549.2496 1096.4846 1096.4753 8.44 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
GDARMMASSR + Oxidation (M)
3492 657.2986 1968.8741 1968.8638 5.26 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
WDKGYDVLQYFEMMK + Deamidated (NQ); Oxidation (M)
5482 819.3723 2455.0951 2455.1393 -18.0 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
NISKNMQNTMGQVTTSAEQMLK + 2 Deamidated (NQ)
1555 508.7311 1015.4477 1015.4458 1.91 0 1 2.1 +1Score > 17 indicates identity GNNQPDIQK + 3 Deamidated (NQ)
5486 819.3723 3273.4602 3273.4363 7.30 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
YNGLPSMEIQGEAAPGTSSGDAMALMENLASK + 2 Deamidated (NQ); 2 Oxidation (M)
1734 522.2372 1563.6899 1563.6987 -5.64 0 1 3.6 +1Score > 19 indicates identity YQDHMINTLADAR + Deamidated (NQ); Oxidation (M)
2295 562.7557 2246.9936 2246.9606 14.7 0 1 2.8 +1Score > 18 indicates identity HNIEAQHMTIDTNGQMVMK + 2 Deamidated (NQ); 3 Oxidation (M)
3211 630.2864 1258.5582 1258.5789 -16.5 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
DDGLILNDNGGR + Deamidated (NQ)
3518 657.2986 1968.8741 1968.9099 -18.2 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
AQQAIQGAATMYGVGVETR + 3 Deamidated (NQ); Oxidation (M)
6523 900.4092 2698.2057 2698.1976 3.00 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
MARMNPEDIGYINAHGTGTPHNDR + 2 Oxidation (M)
123 387.1759 1544.6744 1544.6889 -9.41 0 1 1.8 +1Score > 16 indicates identity QAGCTLHEVGTTNR + 2 Deamidated (NQ)
741 441.2004 1320.5795 1320.5543 19.0 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
YSQNAALDMYK + 2 Deamidated (NQ); Oxidation (M)
5136 792.3600 3165.4111 3165.4019 2.91 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
DPDEWDYQAMEQAINAEIQSLIAACQR + Deamidated (NQ)
5814 846.3846 2536.1319 2536.0967 13.9 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
AAGLPAFTVMSCDNMPENGHVMR + 2 Oxidation (M)
7213 954.4337 1906.8529 1906.8771 -12.7 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
IAFLFTGQGSQYVNMGR + 3 Deamidated (NQ); Oxidation (M)
1741 522.2372 2084.9199 2084.9217 -0.86 0 1 3.7 +1Score > 19 indicates identity MNLDDIINSMMPEVYQR + Deamidated (NQ); Oxidation (M)
5447 819.3723 3273.4602 3273.4363 7.30 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
YNGLPSMEIQGEAAPGTSSGDAMALMENLASK + 2 Deamidated (NQ); 2 Oxidation (M)
1105 468.2127 1401.6163 1401.6194 -2.24 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
TLPPGCEGEEASR
3376 643.7925 2571.1411 2571.1655 -9.51 0 1 3 +1Score > 18 indicates identity LISMMDGDISVDSEPGMGSQFTVR
5702 832.8785 1663.7424 1663.7723 -18.0 0 1 3.5 +1Score > 19 indicates identity MTQQGDAVAGELATEK + Oxidation (M)
6163 873.3969 3489.5585 3489.5641 -1.58 1 1 0.78 +1Score > 22 indicates identity
Score > 13 indicates homology
NIAMVFQNYALYPHMTVYDNMAFGLKMQK + 4 Deamidated (NQ); 3 Oxidation (M)
1266 481.7188 961.4231 961.4063 17.6 0 1 2.6 +1Score > 18 indicates identity METPQPDK + Deamidated (NQ); Oxidation (M)
2838 603.2741 1204.5337 1204.5394 -4.73 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
EAAASEKDPCK
3299 643.7925 2571.1411 2571.1655 -9.51 0 1 3 +1Score > 18 indicates identity LISMMDGDISVDSEPGMGSQFTVR
3847 684.3109 2049.9109 2049.9136 -1.29 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
MLDMGFAQDIEHIAGETR + Deamidated (NQ); Oxidation (M)
4153 711.3232 2841.2639 2841.3028 -13.7 1 1 0.97 +1Score > 21 indicates identity
Score > 14 indicates homology
NVSLMPGVRYDYDNYLSNHNISPR + 2 Deamidated (NQ); Oxidation (M)
5125 792.3600 3165.4111 3165.4648 -17.0 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
QGLMIEQHVEAELANDPPNDLMWWRR + 2 Deamidated (NQ); Oxidation (M)
6867 927.4214 2779.2425 2779.2945 -18.7 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
GMNLVGYDAMAIGNHEFDNPLTVLR + Deamidated (NQ); 2 Oxidation (M)
363 414.1881 1652.7235 1652.7069 10.0 1 1 3.6 +1Score > 19 indicates identity RMGELMAESHASMR + 3 Oxidation (M)
7160 954.4337 1906.8529 1906.8367 8.51 0 1 0.93 +1Score > 21 indicates identity
Score > 13 indicates homology
EQLALEHESYEMGEAR + Oxidation (M)
790 441.2004 880.3863 880.3926 -7.17 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
QFNDSLR + 2 Deamidated (NQ)
816 441.2004 1320.5795 1320.6058 -19.9 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
DNNRVGFAEAAR + 2 Deamidated (NQ)
2184 549.2496 1096.4846 1096.5036 -17.4 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
LSTSFQEER + Deamidated (NQ)
2483 576.2618 1150.5091 1150.5288 -17.1 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
TGDIMTIGGNR + Deamidated (NQ); Oxidation (M)
3443 657.2986 2625.1655 2625.2017 -13.8 0 1 0.93 +1Score > 21 indicates identity
Score > 13 indicates homology
AAPENAVANAYDMVINGYEVGGGSVR + 2 Deamidated (NQ)
4364 724.8293 2895.2883 2895.2691 6.62 1 1 2.9 +1Score > 18 indicates identity AIDSISNGYTYFDSVHMDCEKISSR + Deamidated (NQ)
5836 846.3846 2536.1319 2536.0958 14.2 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
STQSHMFDGISLTEHQRQQMR + 4 Deamidated (NQ); Oxidation (M)
6556 900.4092 3597.6076 3597.6557 -13.4 1 1 0.86 +1Score > 20 indicates identity
Score > 13 indicates homology
AEIWSYGIRNPQGMAMNPWSNALWLNEHGPR + 3 Deamidated (NQ)
244 400.6820 1598.6989 1598.7113 -7.76 0 1 1.7 +1Score > 16 indicates identity EHEHEIAWYTER
579 427.6943 1706.7481 1706.7716 -13.7 1 1 1.6 +1Score > 16 indicates identity MDSNNQIEPCLSRK + Oxidation (M)
706 441.2004 1760.7727 1760.7709 0.99 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
VAAQHSMMPAETESEK + Oxidation (M)
3197 630.2864 1258.5582 1258.5789 -16.5 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
DDGLILNDNGGR + Deamidated (NQ)
4777 765.3478 3057.3620 3057.3106 16.8 0 1 0.89 +1Score > 21 indicates identity
Score > 13 indicates homology
ATTDSGMTTNNPTLQTTPTDDQFTNNGGR + 2 Deamidated (NQ)
3477 657.2986 2625.1655 2625.2050 -15.1 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
QAKGEFLMSDMLAVEQETNNDVR + Deamidated (NQ)
4910 765.3478 3057.3620 3057.3637 -0.54 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
YVTQEELRQMMQPDNGLQWSPWFR + 3 Deamidated (NQ); Oxidation (M)
5114 792.3600 2374.0583 2374.0423 6.75 0 1 0.91 +1Score > 21 indicates identity
Score > 13 indicates homology
IEYVGNGYINEAQNMGWLQR + 4 Deamidated (NQ); Oxidation (M)
7168 954.4337 1906.8529 1906.8690 -8.46 1 1 0.95 +1Score > 21 indicates identity
Score > 13 indicates homology
LSAEDNARVNVAMNQTR + 3 Deamidated (NQ); Oxidation (M)
1950 535.7434 2138.9445 2138.9348 4.57 0 1 2.5 +1Score > 18 indicates identity LSESENVDDVSVMMGTPANK + Deamidated (NQ); Oxidation (M)
2707 589.7679 1177.5213 1177.5397 -15.6 1 1 3.3 +1Score > 19 indicates identity NDRMPDSSLK + Oxidation (M)
4154 711.3232 2841.2639 2841.2983 -12.1 1 1 0.88 +1Score > 21 indicates identity
Score > 13 indicates homology
NVGEAIADFNMIEEGDRIMVCLSGGK + Deamidated (NQ); Oxidation (M)
4432 738.3355 1474.6565 1474.6510 3.68 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
QWENGKCAIPDR + 2 Deamidated (NQ)
6296 886.9030 3543.5830 3543.5916 -2.44 0 1 3.6 +1Score > 19 indicates identity INQTTPGILVSCDSNNNFACQTTMTEDVIQR + Deamidated (NQ); Oxidation (M)
1462 495.2250 1976.8708 1976.8828 -6.08 0 1 0.85 +1Score > 20 indicates identity
Score > 13 indicates homology
GCMGVDIGSAMTYMLLAR + 2 Oxidation (M)
1524 495.2250 1482.6531 1482.6820 -19.5 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
GYDRAMGARPMAR + 2 Oxidation (M)
Page: Previous 1 9 10 11 12 13 14 15 16 17 18 19  76 Next 

Not what you expected? Try the select summary.