MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 4 Dec 2025 at 15:28:39 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1201–1300 (out of 7566)

Page: Previous 1 …8 9 10 11 12 13 14 15 16 17 18 … 76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3121 630.2864 1887.8373 1887.8461 -4.68 0 2 0.91 +1Score > 20 indicates identity
Score > 14 indicates homology		 AQAAQPDQLMSDYFFR + Deamidated (NQ)
3916 697.8171 2787.2392 2787.2349 1.54 1 2 3.3 +1Score > 19 indicates identity MHQMMHDNVHPPGNMAVLVNAPRR + 4 Deamidated (NQ); 2 Oxidation (M)
4516 738.3355 2211.9847 2211.9841 0.26 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 ECDYSQALLEQVNQAISDK + 2 Deamidated (NQ)
323 400.6820 1598.6989 1598.6990 -0.051 0 2 1.5 +1Score > 16 indicates identity SDVTPALSEMMQMK + 2 Oxidation (M)
740 441.2004 1320.5795 1320.5656 10.5 0 2 0.98 +1Score > 20 indicates identity
Score > 14 indicates homology		 MDAWLSGPNANK + 2 Deamidated (NQ); Oxidation (M)
1682 508.7311 2030.8955 2030.8646 15.2 0 2 1.9 +1Score > 17 indicates identity EGYHQDWNTLIYNYGR + 3 Deamidated (NQ)
3270 643.7925 2571.1411 2571.1390 0.82 1 2 2.7 +1Score > 18 indicates identity MQTQMQTQQIQQKGMLNQQLK + 7 Deamidated (NQ); 2 Oxidation (M)
6482 900.4092 3597.6076 3597.6790 -19.8 0 2 0.7 +1Score > 20 indicates identity
Score > 13 indicates homology		 IDVMLDSDGQFYLLEANTSPGMTSHSLVPMAAR + 2 Oxidation (M)
3091 630.2864 2517.1164 2517.1127 1.48 0 2 0.87 +1Score > 20 indicates identity
Score > 14 indicates homology		 MFSMHNCQINPGAGPEITTPWK + 2 Deamidated (NQ)
4542 738.3355 1474.6565 1474.6656 -6.22 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 SNEAGRNMMAHIK + Deamidated (NQ); Oxidation (M)
4554 738.3355 2211.9847 2212.0075 -10.3 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 IMLRTEHDNEEMSVPMHK + Oxidation (M)
5359 805.8662 1609.7179 1609.7107 4.44 0 2 2.7 +1Score > 19 indicates identity TLNSNQFDNEDAIK + 2 Deamidated (NQ)
1310 481.7188 1922.8463 1922.8516 -2.78 1 2 2.4 +1Score > 18 indicates identity VCLGCHFTGYPDQRGR + Deamidated (NQ)
2808 603.2741 1204.5337 1204.5394 -4.75 1 2 0.91 +1Score > 20 indicates identity
Score > 14 indicates homology		 ADEPKCGATEK
4104 711.3232 1420.6319 1420.6504 -13.0 0 2 0.87 +1Score > 21 indicates identity
Score > 14 indicates homology		 ENITNLDACITR + 2 Deamidated (NQ)
6566 900.4092 1798.8038 1798.8151 -6.27 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 VMQVSAMADQMLLDSK + Deamidated (NQ); 2 Oxidation (M)
7484 980.1954 3916.7526 3916.7167 9.17 1 2 2.6 +1Score > 18 indicates identity DGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNK + 7 Deamidated (NQ); Oxidation (M)
1656 508.7311 1015.4477 1015.4458 1.91 0 2 1.9 +1Score > 17 indicates identity GNNQPDIQK + 3 Deamidated (NQ)
4149 711.3232 2841.2639 2841.3023 -13.5 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 TIEATAPGCFEVFIHNDMEAAMKVK + Deamidated (NQ); 2 Oxidation (M)
6814 927.4214 3705.6567 3705.7232 -18.0 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 SVVSGATPVMRDSEHFFFDLPSFSEMLQAWTR + 2 Oxidation (M)
3473 657.2986 2625.1655 2625.2050 -15.1 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 QAKGEFLMSDMLAVEQETNNDVR + Deamidated (NQ)
6870 927.4214 3705.6567 3705.6901 -9.03 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 IIFLHMMGSHPNPCDSLNSVPNNYLEQYPRK + 3 Deamidated (NQ); 2 Oxidation (M)
2576 589.7679 2355.0427 2355.0801 -15.9 1 2 3 +1Score > 19 indicates identity LDELCQDAAGVNFNGFASRLR + 3 Deamidated (NQ)
4226 711.3232 1420.6319 1420.6551 -16.3 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 QQMRDLMQQAR + Deamidated (NQ); Oxidation (M)
5454 819.3723 2455.0951 2455.1393 -18.0 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 NISKNMQNTMGQVTTSAEQMLK + 2 Deamidated (NQ)
7252 954.4337 3813.7058 3813.7423 -9.58 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 MLVSQDKTTTDPMAVVDWINMFALAVNEENAAGGR + 4 Deamidated (NQ); Oxidation (M)
937 454.7066 907.3986 907.3817 18.6 1 2 2.2 +1Score > 17 indicates identity ENMGRER + Deamidated (NQ); Oxidation (M)
1280 481.7188 961.4231 961.4253 -2.30 0 2 2.4 +1Score > 18 indicates identity SGNDLHYR + Deamidated (NQ)
262 400.6820 1598.6989 1598.7186 -12.3 1 2 1.6 +1Score > 16 indicates identity GGQHSGGNFKNDPQR + Deamidated (NQ)
987 454.7066 1814.7972 1814.8100 -7.07 0 2 2.2 +1Score > 17 indicates identity VMQVSAMADQMLLDSK + Deamidated (NQ); 3 Oxidation (M)
2332 562.7557 1123.4968 1123.4824 12.8 1 2 2.6 +1Score > 18 indicates identity RQMMGMEPK + Deamidated (NQ); Oxidation (M)
2985 616.7802 1231.5459 1231.5680 -18.0 0 2 2.5 +1Score > 18 indicates identity TDAEQAQELAR + Deamidated (NQ)
3128 630.2864 2517.1164 2517.1189 -1.00 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 KLQLSMDPMLDMMGMQMLMEK + Deamidated (NQ); Oxidation (M)
4355 724.8293 2895.2883 2895.2778 3.61 1 2 2.6 +1Score > 18 indicates identity QPPMQQFIDNMMDASDHPKFAQYR + Deamidated (NQ)
5200 792.3600 3165.4111 3165.4570 -14.5 1 2 0.95 +1Score > 21 indicates identity
Score > 14 indicates homology		 LSITDVCNFRCTYCLPDGYKPSGVTNK + Deamidated (NQ)
5695 832.8785 3327.4848 3327.4700 4.44 0 2 3.3 +1Score > 19 indicates identity HMSSGNTTDNGIFGLFYGISPGYMDGVLSTR + 2 Deamidated (NQ); 2 Oxidation (M)
6178 873.3969 3489.5585 3489.6244 -18.9 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 AQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQK + 2 Deamidated (NQ)
7404 967.9399 1933.8652 1933.8914 -13.5 0 2 3.3 +1Score > 19 indicates identity IPADHMVLMAGFTAGNEK + Deamidated (NQ); 2 Oxidation (M)
2487 576.2618 2301.0183 2301.0140 1.85 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 RVINSFNSELMGEMSNNNIK + 5 Deamidated (NQ)
2623 589.7679 2355.0427 2355.0796 -15.7 1 2 3 +1Score > 19 indicates identity NFVLMQQKMAAGENPAAEMIK + 3 Deamidated (NQ); 2 Oxidation (M)
3656 670.8048 2679.1901 2679.2287 -14.4 0 2 3.2 +1Score > 19 indicates identity EPLTIDPADSSVLTGEYSVIDNSEE
1248 481.7188 1922.8463 1922.8516 -2.78 1 2 2.4 +1Score > 18 indicates identity VCLGCHFTGYPDQRGR + Deamidated (NQ)
1287 481.7188 1922.8463 1922.8778 -16.4 0 2 2.4 +1Score > 18 indicates identity SANMTLEQLESLNAEQK + 2 Deamidated (NQ); Oxidation (M)
2541 576.2618 1150.5091 1150.5111 -1.69 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 LMGMTPTGNGR + Deamidated (NQ); Oxidation (M)
1461 495.2250 1482.6531 1482.6773 -16.3 1 2 0.79 +1Score > 20 indicates identity
Score > 13 indicates homology		 DQYAGAVETMRNK + Deamidated (NQ)
6479 900.4092 2698.2057 2698.1976 3.00 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 MARMNPEDIGYINAHGTGTPHNDR + 2 Oxidation (M)
7319 967.9399 3867.7304 3867.7558 -6.56 1 2 3.3 +1Score > 19 indicates identity ELAEHNGAEGDLEADYQAASDHLNLVQTALRQQEK + 5 Deamidated (NQ)
336 400.6820 1598.6989 1598.7186 -12.3 1 2 1.6 +1Score > 16 indicates identity GGQHSGGNFKNDPQR + Deamidated (NQ)
3438 657.2986 1968.8741 1968.8849 -5.48 0 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 GVEAVMYMGTLSYEQFK + Deamidated (NQ); Oxidation (M)
4829 765.3478 1528.6810 1528.6715 6.21 0 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 EMEQTAFSAELTR + Deamidated (NQ); Oxidation (M)
299 400.6820 1598.6989 1598.7107 -7.36 1 2 1.6 +1Score > 16 indicates identity TGQICQSQRHRPQ + 4 Deamidated (NQ)
789 441.2004 1760.7727 1760.7896 -9.60 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 FRTTTGDAMGMNMISK + Deamidated (NQ)
1268 481.7188 1922.8463 1922.8768 -15.9 0 2 2.5 +1Score > 18 indicates identity GVAMVFPGQGAQWQGMAR + Deamidated (NQ); 2 Oxidation (M)
1802 522.2372 2084.9199 2084.9109 4.29 0 2 3.4 +1Score > 19 indicates identity LDELCQDAAGVNFNGFASR + 2 Deamidated (NQ)
2525 576.2618 1725.7637 1725.7628 0.53 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 LAQQQAMYESQQER + Deamidated (NQ); Oxidation (M)
3424 657.2986 1312.5827 1312.5830 -0.17 0 2 0.94 +1Score > 21 indicates identity
Score > 14 indicates homology		 NHCEILQGNAR + 2 Deamidated (NQ)
3934 697.8171 1393.6196 1393.6474 -19.9 1 2 3.4 +1Score > 19 indicates identity NVDKQTQDFAAR + 2 Deamidated (NQ)
4002 697.8171 2787.2392 2787.2837 -15.9 1 2 3.4 +1Score > 19 indicates identity GYGYNIDSLLDFFKSELSESDMIK + Deamidated (NQ); Oxidation (M)
56 387.1759 1544.6744 1544.6594 9.70 0 2 1.7 +1Score > 16 indicates identity MQEALMSLMQMAK + 2 Deamidated (NQ); 2 Oxidation (M)
1322 481.7188 1922.8463 1922.8503 -2.07 0 2 2.5 +1Score > 18 indicates identity MALDHLDGFAMDVAQTR + Deamidated (NQ); 2 Oxidation (M)
4446 738.3355 2949.3129 2949.3208 -2.66 0 2 0.75 +1Score > 20 indicates identity
Score > 13 indicates homology		 EWAQAGFLNIVGGCCGTTPQHIAAMSR + 2 Deamidated (NQ); Oxidation (M)
6595 900.4092 1798.8038 1798.8196 -8.77 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 MQQLASFLSGTWQSGR + 3 Deamidated (NQ)
5163 792.3600 1582.7055 1582.7272 -13.7 0 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 QAMAMDFSWQVAAK
2169 549.2496 2192.9692 2192.9500 8.75 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 MHGNSEMQKINQTSAMPEK + Deamidated (NQ); 2 Oxidation (M)
2990 616.7802 1231.5459 1231.5680 -18.0 0 1 2.6 +1Score > 18 indicates identity TDAEQAQELAR + Deamidated (NQ)
3520 657.2986 1312.5827 1312.5643 14.0 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 HDVKGDNEENR + Deamidated (NQ)
3527 657.2986 1312.5827 1312.5825 0.17 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 VSMPEITAMMR + 3 Oxidation (M)
31 387.1759 772.3372 772.3351 2.67 0 1 1.7 +1Score > 16 indicates identity AQGEDPR + Deamidated (NQ)
485 414.1881 1652.7235 1652.7174 3.66 0 1 3.3 +1Score > 19 indicates identity FAPTSSPEQMAMAQR + 2 Deamidated (NQ)
4440 738.3355 2949.3129 2949.3208 -2.66 0 1 0.75 +1Score > 20 indicates identity
Score > 13 indicates homology		 EWAQAGFLNIVGGCCGTTPQHIAAMSR + 2 Deamidated (NQ); Oxidation (M)
4598 751.8416 3003.3374 3003.3808 -14.5 0 1 3.1 +1Score > 19 indicates identity AQMINSYDNSVTYVDHFISSVIDQVR + 3 Deamidated (NQ)
5122 792.3600 1582.7055 1582.6821 14.8 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 CDLQNYGDSATLPK + 2 Deamidated (NQ)
7245 954.4337 2860.2793 2860.2281 17.9 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 LQNAIFQDCNMYKTNFNFAIMEK + 5 Deamidated (NQ); Oxidation (M)
320 400.6820 1598.6989 1598.7222 -14.5 0 1 1.6 +1Score > 16 indicates identity IIPGFMCQGGDFTR + Deamidated (NQ)
2624 589.7679 2355.0427 2355.0181 10.4 1 1 3.1 +1Score > 19 indicates identity DIHPKYEEITASCSCGNVMK + Deamidated (NQ); Oxidation (M)
4262 724.8293 2895.2883 2895.3385 -17.3 0 1 2.7 +1Score > 18 indicates identity QAYGQALAMYHGQTYQIAPEQPLGDK + 2 Deamidated (NQ); Oxidation (M)
6840 927.4214 1852.8283 1852.8486 -10.9 1 1 0.88 +1Score > 21 indicates identity
Score > 13 indicates homology		 SGQMISAQLQNAHRHR + 4 Deamidated (NQ); Oxidation (M)
7306 967.9399 1933.8652 1933.8476 9.12 0 1 3.4 +1Score > 19 indicates identity MSTQYETQGYTINNAGR + Deamidated (NQ)
797 441.2004 1320.5795 1320.5980 -14.0 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 DQDTVMLNDVR + Oxidation (M)
900 454.7066 1814.7972 1814.7815 8.66 1 1 2.3 +1Score > 17 indicates identity LCNSEFCGENLSKQK + 2 Deamidated (NQ)
5481 819.3723 2455.0951 2455.1359 -16.6 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 DLNMDCIVAEIKAQYDDIASR + Oxidation (M)
6710 913.9153 3651.6320 3651.5783 14.7 1 1 3.3 +1Score > 19 indicates identity AGDNGVTGGYSQFFGLKHQMSFDNGMNWNNALR + 3 Deamidated (NQ); Oxidation (M)
499 414.1881 1652.7235 1652.7273 -2.32 0 1 3.4 +1Score > 19 indicates identity EMVSEMVANDLEAAK + Deamidated (NQ); Oxidation (M)
1465 495.2250 1976.8708 1976.8686 1.09 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 FEQADWHAVQQAMKNR + 3 Deamidated (NQ); Oxidation (M)
2456 576.2618 2301.0183 2300.9751 18.7 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 MSAIENFDAHTPMMQQYLR + 3 Deamidated (NQ); Oxidation (M)
3101 630.2864 2517.1164 2517.1251 -3.44 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 SLPMLQVALDNQTMDSAYETTR + 2 Deamidated (NQ); 2 Oxidation (M)
3755 684.3109 2049.9109 2049.9500 -19.0 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 QDAVQHAQQLLKMMGYGV + 2 Deamidated (NQ); 2 Oxidation (M)
5338 805.8662 3219.4357 3219.4917 -17.4 1 1 2.9 +1Score > 19 indicates identity SALQYKVHYDTTLNGGFATAMALNADATEK + 3 Deamidated (NQ); Oxidation (M)
5617 832.8785 3327.4848 3327.4700 4.44 0 1 3.4 +1Score > 19 indicates identity HMSSGNTTDNGIFGLFYGISPGYMDGVLSTR + 2 Deamidated (NQ); 2 Oxidation (M)
426 414.1881 826.3617 826.3677 -7.23 0 1 3.4 +1Score > 19 indicates identity MATVSMR + 2 Oxidation (M)
2019 535.7434 2138.9445 2138.9716 -12.7 1 1 2.3 +1Score > 18 indicates identity ITGSQVKNNGYVQDTNNQR + 4 Deamidated (NQ)
6633 913.9153 1825.8160 1825.8305 -7.91 1 1 3.3 +1Score > 19 indicates identity FYDENKNPMPSELSR
2523 576.2618 2301.0183 2301.0140 1.85 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 RVINSFNSELMGEMSNNNIK + 5 Deamidated (NQ)
2569 589.7679 2355.0427 2355.0796 -15.7 1 1 3.1 +1Score > 19 indicates identity NFVLMQQKMAAGENPAAEMIK + 3 Deamidated (NQ); 2 Oxidation (M)
5453 819.3723 2455.0951 2455.1393 -18.0 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 NISKNMQNTMGQVTTSAEQMLK + 2 Deamidated (NQ)
6636 913.9153 3651.6320 3651.5835 13.3 0 1 3.3 +1Score > 19 indicates identity AETYFVALDDTGHVINSGYQTCAEYDTDPQAAK + 2 Deamidated (NQ)
7540 980.1954 3916.7526 3916.7344 4.65 1 1 2.7 +1Score > 18 indicates identity DMTYGMMLDHFFDDSELKMVLSGQWGYVGLAPSK + Deamidated (NQ); 3 Oxidation (M)
139 387.1759 1544.6744 1544.7003 -16.8 0 1 1.8 +1Score > 16 indicates identity LYPFEMSGGMLQR + Deamidated (NQ); Oxidation (M)
4285 724.8293 2895.2883 2895.3457 -19.8 1 1 2.7 +1Score > 18 indicates identity FDICGSVSEPIPDNRYGVSNGELTGGR
7542 980.1954 3916.7526 3916.7270 6.56 0 1 2.7 +1Score > 18 indicates identity LMPNVAAFNSDNPANPYMEGEVNLGMIWNGSAFVAR + 5 Deamidated (NQ); Oxidation (M)
Page: Previous 1 …8 9 10 11 12 13 14 15 16 17 18 … 76 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/