MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 4 Dec 2025 at 15:28:39 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1101–1200 (out of 7566)

Page: Previous 1 …7 8 9 10 11 12 13 14 15 16 17 … 76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
908 454.7066 907.3986 907.3817 18.6 1 2 2 +1Score > 17 indicates identity ENMGRER + Deamidated (NQ); Oxidation (M)
1507 495.2250 1976.8708 1976.8682 1.33 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 YEMLDAIQPQMATMFR + Deamidated (NQ); 2 Oxidation (M)
2846 603.2741 2409.0673 2409.1086 -17.1 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 AGTMSGGEQQMLAIGRALMSNPR + 2 Deamidated (NQ); 2 Oxidation (M)
5026 778.8539 3111.3864 3111.3978 -3.66 1 2 2.5 +1Score > 18 indicates identity SWGMPDQAKLSQAQAEQLEQAYQAATGGK + 4 Deamidated (NQ); Oxidation (M)
2159 549.2496 1096.4846 1096.4906 -5.48 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 MIHQQHMR + Deamidated (NQ); Oxidation (M)
2248 562.7557 2246.9936 2247.0008 -3.19 1 2 2.4 +1Score > 18 indicates identity NPARQQMLPNTNGGMLNSNR + 3 Deamidated (NQ); 2 Oxidation (M)
2566 589.7679 2355.0427 2355.0300 5.37 1 2 2.8 +1Score > 19 indicates identity FDGNYKDGMTVWLFSCNTGK + Oxidation (M)
3603 670.8048 2679.1901 2679.2421 -19.4 1 2 3 +1Score > 19 indicates identity RAVNPAVMMNDTLFNALNDWVDR + 2 Deamidated (NQ); Oxidation (M)
4486 738.3355 1474.6565 1474.6582 -1.21 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 AECQNQQGNLRR + 2 Deamidated (NQ)
225 400.6820 1598.6989 1598.7113 -7.76 0 2 1.5 +1Score > 16 indicates identity EHEHEIAWYTER
1749 522.2372 2084.9199 2084.9217 -0.87 0 2 3.1 +1Score > 19 indicates identity MWMAGQGTIQISDQMNIK + 2 Deamidated (NQ); 2 Oxidation (M)
2507 576.2618 2301.0183 2301.0253 -3.07 0 2 0.81 +1Score > 20 indicates identity
Score > 13 indicates homology		 AVSDNDDMMILVVDDHPINR + Deamidated (NQ); 2 Oxidation (M)
3429 657.2986 2625.1655 2625.2088 -16.5 0 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 LMEIAQQQHAQQQTAGADASANNAK + 2 Deamidated (NQ)
503 414.1881 1239.5426 1239.5587 -13.0 1 2 3 +1Score > 19 indicates identity TLKEMAQSCR + Deamidated (NQ); Oxidation (M)
798 441.2004 1320.5795 1320.5980 -14.0 0 2 0.69 +1Score > 20 indicates identity
Score > 13 indicates homology		 TLGEMNGDAELR + Oxidation (M)
308 400.6820 799.3495 799.3395 12.4 0 2 1.5 +1Score > 16 indicates identity HGDAGGMR
2133 549.2496 2192.9692 2193.0081 -17.8 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 MSCEELEIVWNNIKAEAR + 2 Deamidated (NQ)
2236 562.7557 1123.4968 1123.5179 -18.8 0 2 2.4 +1Score > 18 indicates identity SASLSDIEMR + Oxidation (M)
247 400.6820 799.3495 799.3460 4.28 0 2 1.5 +1Score > 16 indicates identity ATDDHNK
301 400.6820 1598.6989 1598.7001 -0.74 0 2 1.5 +1Score > 16 indicates identity FANSLFVNNWDNR + 3 Deamidated (NQ)
1692 508.7311 2030.8955 2030.9037 -4.05 1 2 1.8 +1Score > 17 indicates identity HGNSEMQKINQTSAMPEK + 2 Deamidated (NQ)
1834 522.2372 1563.6899 1563.7205 -19.6 0 2 3.2 +1Score > 19 indicates identity AADAAFAEWGQTTPK + Deamidated (NQ)
2297 562.7557 1123.4968 1123.4968 0.031 1 2 2.4 +1Score > 18 indicates identity MREYPNGEK + Deamidated (NQ)
2945 616.7802 2463.0917 2463.0656 10.6 0 2 2.4 +1Score > 18 indicates identity MSSGGAANGSYHSNGLGGHIETGMR + Oxidation (M)
6602 900.4092 3597.6076 3597.6697 -17.3 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 VKSWWVNAGEAFMIYSLAENFCSSNGYTLPR + Deamidated (NQ)
7314 967.9399 3867.7304 3867.7583 -7.20 1 2 3.1 +1Score > 19 indicates identity YGALMQTISGVHYNFSLPMAFWQAKCGDISGADAK + 2 Deamidated (NQ); 2 Oxidation (M)
359 414.1881 1652.7235 1652.7069 10.0 1 2 3.1 +1Score > 19 indicates identity RMGELMAESHASMR + 3 Oxidation (M)
1794 522.2372 2084.9199 2084.9507 -14.8 0 2 3.2 +1Score > 19 indicates identity DAHMEANLEMEIVPQGLR + Deamidated (NQ); 2 Oxidation (M)
3127 630.2864 1258.5582 1258.5789 -16.5 0 2 0.81 +1Score > 20 indicates identity
Score > 13 indicates homology		 DDGLILNDNGGR + Deamidated (NQ)
4003 697.8171 2787.2392 2787.2837 -15.9 1 2 3.1 +1Score > 19 indicates identity GYGYNIDSLLDFFKSELSESDMIK + Deamidated (NQ); Oxidation (M)
5142 792.3600 1582.7055 1582.7032 1.46 0 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 NDSTIGVTVASMEDK + Deamidated (NQ); Oxidation (M)
5474 819.3723 1636.7301 1636.7119 11.1 1 2 0.8 +1Score > 21 indicates identity
Score > 13 indicates homology		 RMGELMAESHASMR + 2 Oxidation (M)
6794 927.4214 3705.6567 3705.6848 -7.59 0 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 MGNAQLVDSMVADGLTDAYNQYQMGITAENIVEK + Deamidated (NQ); Oxidation (M)
643 427.6943 1706.7481 1706.7576 -5.58 0 2 1.4 +1Score > 16 indicates identity QFDTYNLWNTFTR + 2 Deamidated (NQ)
2784 603.2741 2409.0673 2409.1019 -14.3 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 ATEANCRYLDAILEQYHQGR + 2 Deamidated (NQ)
7052 940.9276 3759.6811 3759.6790 0.56 1 2 3.1 +1Score > 19 indicates identity VESTNSYVLCHLFDQPTHTSAMFICDRCGAVK + Deamidated (NQ); Oxidation (M)
1864 522.2372 2084.9199 2084.9361 -7.77 0 2 3.2 +1Score > 19 indicates identity SDNCEDTPEAGYFAIAVVK
2482 576.2618 1725.7637 1725.7814 -10.3 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 EGMNIVEAMERFGSR + Deamidated (NQ)
6629 913.9153 1825.8160 1825.7900 14.2 0 2 3 +1Score > 19 indicates identity NGYNSAALNGDMNQALR + 2 Deamidated (NQ); Oxidation (M)
6658 913.9153 1825.8160 1825.8438 -15.2 0 2 3 +1Score > 19 indicates identity LDDMLEIQTEITSMR + 2 Oxidation (M)
1288 481.7188 1922.8463 1922.8615 -7.90 1 2 2.3 +1Score > 18 indicates identity MGANDQSVIDRLNWMR + 2 Deamidated (NQ); Oxidation (M)
2121 549.2496 2192.9692 2193.0017 -14.8 1 2 0.96 +1Score > 20 indicates identity
Score > 14 indicates homology		 IAFVCDAGMGSSAMGATTFRK + Oxidation (M)
1836 522.2372 2084.9199 2084.9361 -7.77 0 2 3.2 +1Score > 19 indicates identity SDNCEDTPEAGYFAIAVVK
2060 549.2496 2192.9692 2192.9976 -13.0 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 MALNALDGMLARECNQQTR + 2 Deamidated (NQ)
2432 576.2618 1150.5091 1150.5288 -17.1 0 2 0.85 +1Score > 20 indicates identity
Score > 14 indicates homology		 QTQLTEEMR + Oxidation (M)
3417 657.2986 1968.8741 1968.8517 11.4 1 2 0.93 +1Score > 21 indicates identity
Score > 14 indicates homology		 MTSCNQQATAQALKGDAR + 3 Deamidated (NQ); Oxidation (M)
6618 913.9153 3651.6320 3651.6354 -0.93 1 2 3 +1Score > 19 indicates identity MIPFNAPPVVGTELDYMQSAMGSGKLCGDGGFTR + Deamidated (NQ); 3 Oxidation (M)
756 441.2004 880.3863 880.3926 -7.17 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 DYQQAQK + Deamidated (NQ)
1777 522.2372 2084.9199 2084.9217 -0.87 0 2 3.2 +1Score > 19 indicates identity MWMAGQGTIQISDQMNIK + 2 Deamidated (NQ); 2 Oxidation (M)
1796 522.2372 1563.6899 1563.6722 11.3 0 2 3.2 +1Score > 19 indicates identity LDNNDMIDQLEAR + 2 Deamidated (NQ); Oxidation (M)
2581 589.7679 1177.5213 1177.5325 -9.49 0 2 2.9 +1Score > 19 indicates identity MAYTTFSQTK + Deamidated (NQ)
2863 603.2741 1204.5337 1204.5394 -4.73 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 ADCEQLAELR + Deamidated (NQ)
3432 657.2986 1968.8741 1968.8849 -5.48 0 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 GVEAVMYMGTLSYEQFK + Deamidated (NQ); Oxidation (M)
4220 711.3232 2130.9479 2130.9665 -8.75 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 VASSRTEDTDLQDDSHIDK
4603 751.8416 1501.6687 1501.6586 6.72 0 2 2.9 +1Score > 19 indicates identity AWFAENPQGNDPR + Deamidated (NQ)
6190 873.3969 1744.7793 1744.7864 -4.08 0 2 0.88 +1Score > 22 indicates identity
Score > 14 indicates homology		 ATHTDSVSSEQVDNVR + Deamidated (NQ)
1107 468.2127 1401.6163 1401.6235 -5.11 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 NGGVKQFFMNDK + 2 Deamidated (NQ); Oxidation (M)
1554 508.7311 2030.8955 2030.8979 -1.19 0 2 1.8 +1Score > 17 indicates identity MSMGHEVVGHWFNEEVK + Oxidation (M)
3436 657.2986 1968.8741 1968.8638 5.26 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 WDKGYDVLQYFEMMK + Deamidated (NQ); Oxidation (M)
1618 508.7311 2030.8955 2030.8860 4.68 1 2 1.8 +1Score > 17 indicates identity IRDEMGLAMEEGCGIYR + 2 Oxidation (M)
1624 508.7311 2030.8955 2030.9037 -4.05 1 2 1.8 +1Score > 17 indicates identity HGNSEMQKINQTSAMPEK + 2 Deamidated (NQ)
1857 522.2372 2084.9199 2084.9143 2.69 1 2 3.2 +1Score > 19 indicates identity EAGINNCYLEGEMVQGKR + 2 Deamidated (NQ); Oxidation (M)
5622 832.8785 3327.4848 3327.5071 -6.69 1 2 3.1 +1Score > 19 indicates identity NCATQFISCQDSVAALGMRVLGNPYGNDPR + Deamidated (NQ); Oxidation (M)
6293 886.9030 3543.5830 3543.5187 18.1 1 2 3.1 +1Score > 19 indicates identity QQMLPNTNGGMLNSNRNPDSSLNQQHMLPER + 7 Deamidated (NQ); Oxidation (M)
5608 832.8785 1663.7424 1663.7359 3.91 0 2 3.1 +1Score > 19 indicates identity AMEDQIINDLNDTR + Deamidated (NQ); Oxidation (M)
6317 886.9030 3543.5830 3543.5365 13.1 1 2 3.1 +1Score > 19 indicates identity VDQAQDTLRPNNRLSDMQATMEQTQAFENR + 5 Deamidated (NQ); 2 Oxidation (M)
78 387.1759 1544.6744 1544.6889 -9.41 0 2 1.6 +1Score > 16 indicates identity QAGCTLHEVGTTNR + 2 Deamidated (NQ)
469 414.1881 1652.7235 1652.7385 -9.12 0 2 3.1 +1Score > 19 indicates identity AMMDNLQTETVINR + 2 Deamidated (NQ); Oxidation (M)
6502 900.4092 3597.6076 3597.6558 -13.4 1 2 0.87 +1Score > 20 indicates identity
Score > 14 indicates homology		 MEAAQISQTLNTPQPMINAMLQQLESMGKAVR + 5 Deamidated (NQ); 4 Oxidation (M)
6704 913.9153 1825.8160 1825.8438 -15.2 0 2 3 +1Score > 19 indicates identity LDDMLEIQTEITSMR + 2 Oxidation (M)
302 400.6820 1598.6989 1598.7186 -12.3 1 2 1.5 +1Score > 16 indicates identity GGQHSGGNFKNDPQR + Deamidated (NQ)
1316 481.7188 961.4231 961.4100 13.6 0 2 2.3 +1Score > 18 indicates identity ENANSAQAR + 2 Deamidated (NQ)
1411 495.2250 1976.8708 1976.8422 14.5 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 LGTQANNMHVWSDATGQK + 4 Deamidated (NQ); Oxidation (M)
1785 522.2372 2084.9199 2084.9109 4.29 0 2 3.2 +1Score > 19 indicates identity LDELCQDAAGVNFNGFASR + 2 Deamidated (NQ)
5852 846.3846 1690.7546 1690.7832 -16.9 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 TADQGTNIQTPAQMAK + Deamidated (NQ); Oxidation (M)
6057 859.8907 3435.5339 3435.5688 -10.2 0 2 2.5 +1Score > 18 indicates identity VAQALDDLQNAQNDLASYNSQLVSLQTQPER + 7 Deamidated (NQ)
1473 495.2250 988.4354 988.4219 13.7 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 GNHEVMMR + Oxidation (M)
3130 630.2864 2517.1164 2517.1127 1.48 0 2 0.91 +1Score > 20 indicates identity
Score > 14 indicates homology		 MFSMHNCQINPGAGPEITTPWK + 2 Deamidated (NQ)
3444 657.2986 1968.8741 1968.8591 7.62 0 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 MPNVDVVGEMVNTMSASR + Deamidated (NQ); 2 Oxidation (M)
4789 765.3478 2293.0215 2293.0233 -0.80 0 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 DALYQAIDDALEQSAPATDER + 2 Deamidated (NQ)
5904 846.3846 1690.7546 1690.7832 -16.9 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 TADQGTNIQTPAQMAK + Deamidated (NQ); Oxidation (M)
6654 913.9153 3651.6320 3651.6354 -0.93 1 2 3 +1Score > 19 indicates identity MIPFNAPPVVGTELDYMQSAMGSGKLCGDGGFTR + Deamidated (NQ); 3 Oxidation (M)
6623 913.9153 3651.6320 3651.5790 14.5 1 2 3.1 +1Score > 19 indicates identity DLNNESTPMAFENIKQVIDDMATDATMFDVNK + 3 Deamidated (NQ); 2 Oxidation (M)
1091 468.2127 1401.6163 1401.6062 7.22 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 WNQHGLGGDNFR + 2 Deamidated (NQ)
6160 873.3969 2617.1689 2617.1611 2.99 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 YNWGDGVCLAGSVDATNCLAAMKK + Deamidated (NQ); Oxidation (M)
4107 711.3232 1420.6319 1420.6542 -15.7 1 2 0.72 +1Score > 21 indicates identity
Score > 13 indicates homology		 SKQQNQQTSSER + Deamidated (NQ)
6159 873.3969 1744.7793 1744.8059 -15.3 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 KCPVCHQGEMVSGIK + Oxidation (M)
6821 927.4214 3705.6567 3705.6830 -7.10 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 VMLNEKESAPQLCHHCEDAPCAVVCPVNAITR + Deamidated (NQ)
7167 954.4337 1906.8529 1906.8818 -15.2 0 2 0.88 +1Score > 21 indicates identity
Score > 14 indicates homology		 GVAMVFPGQGAQWQGMAR + Deamidated (NQ); Oxidation (M)
1056 468.2127 1401.6163 1401.6234 -5.10 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 YSEMKFPQNDK + Oxidation (M)
628 427.6943 853.3741 853.3600 16.5 0 2 1.5 +1Score > 16 indicates identity MTSSAGQR + Deamidated (NQ); Oxidation (M)
1635 508.7311 2030.8955 2030.9190 -11.6 1 2 1.9 +1Score > 17 indicates identity YRDMDFIQNVLNGMASR + 2 Deamidated (NQ)
3517 657.2986 1968.8741 1968.8517 11.4 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 MTSCNQQATAQALKGDAR + 3 Deamidated (NQ); Oxidation (M)
494 414.1881 1652.7235 1652.7273 -2.32 0 2 3.2 +1Score > 19 indicates identity EMVSEMVANDLEAAK + Deamidated (NQ); Oxidation (M)
1989 535.7434 1069.4723 1069.4862 -13.1 1 2 2.2 +1Score > 18 indicates identity EAMGFSEKR + Oxidation (M)
3285 643.7925 1285.5705 1285.5795 -6.95 0 2 2.7 +1Score > 18 indicates identity MVTNLYQNMR + Deamidated (NQ); Oxidation (M)
2429 576.2618 1725.7637 1725.7603 1.97 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 GWNLYVCGNGGMKPR + 2 Deamidated (NQ); Oxidation (M)
4604 751.8416 1501.6687 1501.6586 6.72 0 2 3 +1Score > 19 indicates identity AWFAENPQGNDPR + Deamidated (NQ)
5135 792.3600 3165.4111 3165.3696 13.1 0 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 WTGNDIPDFGNAAPGTPTGPFIMQPEGMGR + 3 Deamidated (NQ); 2 Oxidation (M)
844 441.2004 1320.5795 1320.6058 -19.9 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 DNNRVGFAEAAR + 2 Deamidated (NQ)
Page: Previous 1 …7 8 9 10 11 12 13 14 15 16 17 … 76 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/