MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 4 Dec 2025 at 15:28:39 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1001–1100 (out of 7566)

Page: Previous 1 …6 7 8 9 10 11 12 13 14 15 16 … 76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
1427 495.2250 1482.6531 1482.6409 8.23 0 2 0.74 +1Score > 20 indicates identity
Score > 13 indicates homology		 FSSPGQMSGDSLNR + Deamidated (NQ)
3427 657.2986 2625.1655 2625.1397 9.83 1 2 0.64 +1Score > 21 indicates identity
Score > 13 indicates homology		 VDQEYEGIVRQLMTYMMEDSR + Deamidated (NQ); 2 Oxidation (M)
7187 954.4337 3813.7058 3813.6848 5.50 0 2 0.79 +1Score > 21 indicates identity
Score > 14 indicates homology		 LEAGMNLYGQEMDETISPLAANMGWTIAWEPADR + 2 Deamidated (NQ); 2 Oxidation (M)
7274 954.4337 3813.7058 3813.7791 -19.2 0 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 HLNQLNALLESMDDGVISWDEQGNLQFINAQAAR + 4 Deamidated (NQ)
1415 495.2250 988.4354 988.4461 -10.9 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 VNADPESTR + Deamidated (NQ)
2204 549.2496 1096.4846 1096.4753 8.44 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 GDARMMASSR + Oxidation (M)
4909 765.3478 3057.3620 3057.4223 -19.7 0 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 LEIIDNPNDAEMAIVLGDSIPNDSALNGK + 4 Deamidated (NQ); Oxidation (M)
6433 886.9030 3543.5830 3543.6183 -9.97 1 2 2.8 +1Score > 19 indicates identity YSMSLPADSSPSPMNGFDLFTYMAVIVCARGK + 2 Oxidation (M)
7470 980.1954 2937.5645 2937.5124 17.7 1 2 2.2 +1Score > 18 indicates identity DETGNQGFADYVLFVGLKPIAVVEAKR + 2 Deamidated (NQ)
372 414.1881 1652.7235 1652.7069 10.0 1 2 2.8 +1Score > 19 indicates identity RMGELMAESHASMR + 3 Oxidation (M)
660 427.6943 853.3741 853.3600 16.5 0 2 1.3 +1Score > 16 indicates identity MTSSAGQR + Deamidated (NQ); Oxidation (M)
6305 886.9030 3543.5830 3543.5897 -1.90 0 2 2.8 +1Score > 19 indicates identity IIFLHMMGSHPNPCDSLNSPPNNYLEQYPR + 3 Deamidated (NQ)
6855 927.4214 3705.6567 3705.6204 9.80 0 2 0.7 +1Score > 21 indicates identity
Score > 13 indicates homology		 NTDFFGLVNGLNFAVQYQGNNEGASNGQEGTNNGR + 3 Deamidated (NQ)
1172 468.2127 934.4109 934.4290 -19.5 1 2 0.95 +1Score > 20 indicates identity
Score > 14 indicates homology		 DCSLQRR + Deamidated (NQ)
1930 535.7434 2138.9445 2138.9716 -12.7 1 2 1.9 +1Score > 18 indicates identity ITGSQVKNNGYVQDTNNQR + 4 Deamidated (NQ)
3814 684.3109 2733.2145 2733.2527 -13.9 1 2 0.66 +1Score > 20 indicates identity
Score > 13 indicates homology		 NYGPDRVAGFSPIPAMSMVSYASGAR + Deamidated (NQ); 2 Oxidation (M)
3835 684.3109 2049.9109 2049.9360 -12.3 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 IGEMACVAVHPDYRSSSR + Oxidation (M)
360 414.1881 1652.7235 1652.7069 10.0 1 2 2.8 +1Score > 19 indicates identity RMGELMAESHASMR + 3 Oxidation (M)
4847 765.3478 3057.3620 3057.4223 -19.7 0 2 0.64 +1Score > 21 indicates identity
Score > 13 indicates homology		 LEIIDNPNDAEMAIVLGDSIPNDSALNGK + 4 Deamidated (NQ); Oxidation (M)
1081 468.2127 1401.6163 1401.6160 0.18 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 YPHQLSGGQQQR + 4 Deamidated (NQ)
2865 603.2741 1806.8005 1806.8314 -17.1 0 2 0.9 +1Score > 20 indicates identity
Score > 14 indicates homology		 TVAAEMPAMQCLQLAR + 2 Deamidated (NQ); Oxidation (M)
5967 859.8907 3435.5339 3435.5976 -18.5 1 2 2.3 +1Score > 18 indicates identity GVGQYLLEEVLRNNPGVSCWWMADAGVEDR + Oxidation (M)
640 427.6943 853.3741 853.3600 16.5 0 2 1.3 +1Score > 16 indicates identity MTSSAGQR + Deamidated (NQ); Oxidation (M)
884 454.7066 907.3986 907.3891 10.4 0 2 1.9 +1Score > 17 indicates identity DMAMNQAK
946 454.7066 1814.7972 1814.8100 -7.07 0 2 1.9 +1Score > 17 indicates identity VMQVSAMADQMLLDSK + Deamidated (NQ); 3 Oxidation (M)
1481 495.2250 1482.6531 1482.6521 0.67 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 MNNNDLFQASRR + 2 Deamidated (NQ); Oxidation (M)
1273 481.7188 1922.8463 1922.8768 -15.9 0 2 2.1 +1Score > 18 indicates identity GVAMVFPGQGAQWQGMAR + Deamidated (NQ); 2 Oxidation (M)
2090 549.2496 2192.9692 2192.9976 -13.0 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 MALNALDGMLARECNQQTR + 2 Deamidated (NQ)
2226 562.7557 2246.9936 2246.9547 17.3 0 2 2.3 +1Score > 18 indicates identity MYAMGVDAWSLANHFSQMR + Deamidated (NQ); 2 Oxidation (M)
5494 819.3723 2455.0951 2455.1201 -10.2 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 AIAFWQRCVEMSPEFADGWR
1133 468.2127 1868.8217 1868.8322 -5.63 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 RNDPNEMHNLIDDIR + 2 Deamidated (NQ); Oxidation (M)
3117 630.2864 2517.1164 2517.1239 -2.99 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 LYDRGSNGFWPGEGCGMVVLMR + Deamidated (NQ); Oxidation (M)
4101 711.3232 1420.6319 1420.6504 -13.0 0 2 0.74 +1Score > 21 indicates identity
Score > 13 indicates homology		 ENITNLDACITR + 2 Deamidated (NQ)
2643 589.7679 2355.0427 2355.0873 -18.9 1 2 2.6 +1Score > 19 indicates identity SLADHQSAAANDIRQMIQDNR + 2 Deamidated (NQ)
2776 603.2741 2409.0673 2409.1019 -14.3 1 2 0.66 +1Score > 20 indicates identity
Score > 13 indicates homology		 LAGWHVAMDANRNPDPSLDGEK + Deamidated (NQ); Oxidation (M)
4000 697.8171 2787.2392 2787.2837 -15.9 1 2 2.9 +1Score > 19 indicates identity GYGYNIDSLLDFFKSELSESDMIK + Deamidated (NQ); Oxidation (M)
4363 724.8293 2895.2883 2895.3300 -14.4 1 2 2.3 +1Score > 18 indicates identity MQVSCLQMQGDALPESSRELLSQIR + 4 Deamidated (NQ); Oxidation (M)
472 414.1881 1652.7235 1652.7426 -11.6 1 2 2.9 +1Score > 19 indicates identity ETYKYADMLAMSAK + 2 Oxidation (M)
2234 562.7557 1123.4968 1123.5179 -18.8 0 2 2.3 +1Score > 18 indicates identity SASLSDIEMR + Oxidation (M)
4354 724.8293 2895.2883 2895.3459 -19.9 0 2 2.3 +1Score > 18 indicates identity DHLGIIPLYMGYDEHGQLYVASEMK + Deamidated (NQ); Oxidation (M)
1493 495.2250 988.4354 988.4219 13.7 0 2 0.83 +1Score > 20 indicates identity
Score > 14 indicates homology		 GNHEVMMR + Oxidation (M)
1681 508.7311 2030.8955 2030.9037 -4.05 1 2 1.7 +1Score > 17 indicates identity HGNSEMQKINQTSAMPEK + 2 Deamidated (NQ)
3767 684.3109 1366.6073 1366.6153 -5.88 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 AADAYWGKDANGK + Deamidated (NQ)
5119 792.3600 2374.0583 2374.0130 19.1 0 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 LQLSMDPMLDMMGMQMLMEK + 2 Deamidated (NQ)
1988 535.7434 2138.9445 2138.9348 4.57 0 2 2 +1Score > 18 indicates identity LSESENVDDVSVMMGTPANK + Deamidated (NQ); Oxidation (M)
917 454.7066 1814.7972 1814.8100 -7.07 0 2 1.9 +1Score > 17 indicates identity VMQVSAMADQMLLDSK + Deamidated (NQ); 3 Oxidation (M)
2575 589.7679 2355.0427 2355.0796 -15.7 1 2 2.7 +1Score > 19 indicates identity NFVLMQQKMAAGENPAAEMIK + 3 Deamidated (NQ); 2 Oxidation (M)
5890 846.3846 3381.5092 3381.4856 7.00 0 2 0.84 +1Score > 20 indicates identity
Score > 14 indicates homology		 VLEEAQQVSSSSTVSDGGASSSDSNNYATFDLK + 2 Deamidated (NQ)
2357 562.7557 1123.4968 1123.4968 0.031 1 2 2.3 +1Score > 18 indicates identity MREYPNGEK + Deamidated (NQ)
3481 657.2986 1312.5827 1312.5870 -3.26 0 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 SYITGEFGHMR + Oxidation (M)
6588 900.4092 3597.6076 3597.5529 15.2 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 VGCMLAMVPLYPYSCNPDDVMFAQESMRER + 2 Oxidation (M)
7558 980.1954 3916.7526 3916.8290 -19.5 1 2 2.3 +1Score > 18 indicates identity QGGLVMQNYRLIDATLYVTLEPCVMCAGAMIHSR + 2 Deamidated (NQ); 3 Oxidation (M)
2400 576.2618 1150.5091 1150.5012 6.91 0 2 0.98 +1Score > 20 indicates identity
Score > 14 indicates homology		 MHHAMHDLK + 2 Oxidation (M)
135 387.1759 772.3372 772.3391 -2.52 0 2 1.5 +1Score > 16 indicates identity YYNEGK
737 441.2004 1760.7727 1760.7749 -1.30 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 GLMFTQPNQAAGYMAK + 2 Deamidated (NQ); 2 Oxidation (M)
976 454.7066 907.3986 907.3957 3.23 0 2 2 +1Score > 17 indicates identity QMQNELK + 2 Deamidated (NQ); Oxidation (M)
2263 562.7557 2246.9936 2246.9606 14.7 0 2 2.3 +1Score > 18 indicates identity HNIEAQHMTIDTNGQMVMK + 2 Deamidated (NQ); 3 Oxidation (M)
2368 562.7557 1123.4968 1123.5179 -18.8 0 2 2.3 +1Score > 18 indicates identity MTAVSQTETR + Deamidated (NQ)
4181 711.3232 1420.6319 1420.6503 -13.0 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 AEAQIAKMEEQR + 2 Deamidated (NQ); Oxidation (M)
6917 927.4214 1852.8283 1852.8546 -14.2 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 MSKSIGNTVSPQDVMNK + 2 Deamidated (NQ); Oxidation (M)
1434 495.2250 1976.8708 1976.8682 1.33 0 2 0.9 +1Score > 20 indicates identity
Score > 14 indicates homology		 YEMLDAIQPQMATMFR + Deamidated (NQ); 2 Oxidation (M)
3659 670.8048 2679.1901 2679.2308 -15.2 1 2 2.9 +1Score > 19 indicates identity ELGATLSYNMRLGNGMEHEPWLK + 2 Deamidated (NQ); 2 Oxidation (M)
3688 670.8048 1339.5951 1339.6190 -17.9 1 2 2.9 +1Score > 19 indicates identity KDSGFQMNQLR + Deamidated (NQ); Oxidation (M)
4834 765.3478 2293.0215 2292.9845 16.1 0 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 LYSSDNMYPDSQQGFAPTVR + 2 Deamidated (NQ); Oxidation (M)
5620 832.8785 3327.4848 3327.5452 -18.2 1 2 2.9 +1Score > 19 indicates identity IQTWQYSDSQQAISIEDNGCGIDLSLQKK + 3 Deamidated (NQ)
437 414.1881 1652.7235 1652.7174 3.66 0 2 2.9 +1Score > 19 indicates identity FAPTSSPEQMAMAQR + 2 Deamidated (NQ)
2447 576.2618 1725.7637 1725.7767 -7.53 1 2 0.75 +1Score > 20 indicates identity
Score > 13 indicates homology		 EKQSLEQGAMQPSFK + 3 Deamidated (NQ); Oxidation (M)
2687 589.7679 2355.0427 2355.0536 -4.64 1 2 2.7 +1Score > 19 indicates identity METNIVEVENFVQQSEERR + 3 Deamidated (NQ); Oxidation (M)
1110 468.2127 934.4109 934.4243 -14.4 0 2 0.98 +1Score > 20 indicates identity
Score > 14 indicates homology		 TDTQVNAGK + 2 Deamidated (NQ)
2425 576.2618 1725.7637 1725.7515 7.05 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 METASQNLEFEEAAR + Deamidated (NQ)
6963 940.9276 3759.6811 3759.6790 0.56 1 2 2.9 +1Score > 19 indicates identity VESTNSYVLCHLFDQPTHTSAMFICDRCGAVK + Deamidated (NQ); Oxidation (M)
2246 562.7557 1123.4968 1123.4894 6.60 0 2 2.4 +1Score > 18 indicates identity NLNDTNYNR + Deamidated (NQ)
2768 603.2741 1806.8005 1806.7916 4.91 1 2 0.9 +1Score > 20 indicates identity
Score > 14 indicates homology		 MQHETKMENQSWLK + 2 Deamidated (NQ); Oxidation (M)
4787 765.3478 3057.3620 3057.3702 -2.68 1 2 0.79 +1Score > 21 indicates identity
Score > 14 indicates homology		 MKAFPETFLWGGATAANQVEGAWQEDGK + 3 Deamidated (NQ); Oxidation (M)
4260 724.8293 2895.2883 2895.3385 -17.3 0 2 2.4 +1Score > 18 indicates identity QAYGQALAMYHGQTYQIAPEQPLGDK + 2 Deamidated (NQ); Oxidation (M)
4691 751.8416 3003.3374 3003.3808 -14.5 0 2 2.8 +1Score > 19 indicates identity AQMINSYDNSVTYVDHFISSVIDQVR + 3 Deamidated (NQ)
4778 765.3478 1528.6810 1528.6781 1.93 0 2 0.99 +1Score > 21 indicates identity
Score > 14 indicates homology		 TEVEEYTVDNTTK + Deamidated (NQ)
5479 819.3723 2455.0951 2455.1308 -14.5 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 QTPMRGHPVFIAQHATATCCR + Deamidated (NQ); Oxidation (M)
732 441.2004 1760.7727 1760.7749 -1.30 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 GLMFTQPNQAAGYMAK + 2 Deamidated (NQ); 2 Oxidation (M)
932 454.7066 1814.7972 1814.7879 5.09 1 2 2 +1Score > 17 indicates identity KQQLINQANDYMNSK + 5 Deamidated (NQ); Oxidation (M)
2705 589.7679 2355.0427 2355.0280 6.24 1 2 2.8 +1Score > 19 indicates identity GEHHGQKGFFAWFNQMFNR + 2 Deamidated (NQ); Oxidation (M)
2907 616.7802 2463.0917 2463.0521 16.1 0 2 2.3 +1Score > 18 indicates identity TSDVHDATDGVTETALDDEQSTR + Deamidated (NQ)
4903 765.3478 3057.3620 3057.3972 -11.5 0 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 MANWLNQLQSLLGQSSSSTSSSADQGLVK + 5 Deamidated (NQ); Oxidation (M)
5500 819.3723 3273.4602 3273.5169 -17.3 0 2 0.67 +1Score > 21 indicates identity
Score > 13 indicates homology		 MDAFIQYGIVAGVQAMQDSGLEITEENATR + Deamidated (NQ); Oxidation (M)
1521 495.2250 988.4354 988.4396 -4.26 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 NMNPDGKGR + Deamidated (NQ)
5024 778.8539 3111.3864 3111.3978 -3.66 1 2 2.5 +1Score > 18 indicates identity SWGMPDQAKLSQAQAEQLEQAYQAATGGK + 4 Deamidated (NQ); Oxidation (M)
6640 913.9153 3651.6320 3651.6432 -3.06 1 2 2.9 +1Score > 19 indicates identity HSPSFEMHMASDTLNFMPFEKGTLLAQDGEER
194 400.6820 1598.6989 1598.7186 -12.3 1 2 1.4 +1Score > 16 indicates identity GGQHSGGNFKNDPQR + Deamidated (NQ)
1610 508.7311 2030.8955 2030.9255 -14.8 1 2 1.8 +1Score > 17 indicates identity QFEQQGKSVMLAAGDTFR + 3 Deamidated (NQ); Oxidation (M)
2086 549.2496 1096.4846 1096.4753 8.44 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 GDARMMASSR + Oxidation (M)
5131 792.3600 3165.4111 3165.4338 -7.18 0 2 0.99 +1Score > 21 indicates identity
Score > 14 indicates homology		 EMMQTAMQNTMLINGIAQVTFDSETAVK + 4 Oxidation (M)
7502 980.1954 2937.5645 2937.5593 1.76 1 2 2.4 +1Score > 18 indicates identity NLVELAQLARENDAMVIALTSAGTPLAR + Deamidated (NQ)
2536 576.2618 2301.0183 2300.9941 10.5 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 MAHSHSHTSSHLPEDNNARR + 2 Deamidated (NQ); Oxidation (M)
3636 670.8048 1339.5951 1339.6143 -14.4 0 2 3 +1Score > 19 indicates identity TGVSNTLENEFK + 2 Deamidated (NQ)
6806 927.4214 2779.2425 2779.2577 -5.46 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 FSQTMMWIDTVNGLIMVDCASAKK + 2 Deamidated (NQ); 2 Oxidation (M)
272 400.6820 799.3495 799.3460 4.28 0 2 1.4 +1Score > 16 indicates identity ATDDHNK
3425 657.2986 1968.8741 1968.8809 -3.43 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 MVETSQCVPYPAKADEK + Deamidated (NQ); Oxidation (M)
3613 670.8048 2679.1901 2679.1880 0.81 0 2 3 +1Score > 19 indicates identity YVTGGNNQWHTVASLHMTIMMNR + 3 Deamidated (NQ); Oxidation (M)
5373 805.8662 3219.4357 3219.4973 -19.1 1 2 2.6 +1Score > 19 indicates identity VAMMNRLQQALEHNHFFLMAQPITGMR + 4 Deamidated (NQ); 2 Oxidation (M)
5966 859.8907 3435.5339 3435.5818 -14.0 0 2 2.4 +1Score > 18 indicates identity DVNALMTAGQLINWGMPTLAAEMLNALDCQR + 3 Deamidated (NQ); Oxidation (M)
Page: Previous 1 …6 7 8 9 10 11 12 13 14 15 16 … 76 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/