MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 4 Dec 2025 at 15:28:39 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 901–1000 (out of 7566)

Page: Previous 1 …5 6 7 8 9 10 11 12 13 14 15 … 76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
842 441.2004 880.3863 880.3927 -7.21 0 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 TDFDQVR + Deamidated (NQ)
885 454.7066 907.3986 907.3957 3.23 0 3 1.7 +1Score > 17 indicates identity QMQNELK + 2 Deamidated (NQ); Oxidation (M)
1613 508.7311 2030.8955 2030.9044 -4.38 0 3 1.5 +1Score > 17 indicates identity DNGFFPNFSIAQNMAISR + 3 Deamidated (NQ)
2097 549.2496 1644.7269 1644.7314 -2.77 0 3 0.74 +1Score > 20 indicates identity
Score > 14 indicates homology		 QDLCHFEGNAQGIR + Deamidated (NQ)
6358 886.9030 3543.5830 3543.5996 -4.70 0 3 2.6 +1Score > 19 indicates identity SLGSIMTGSAYPGLWNLTYTPGDMSSMAEAYTR + Oxidation (M)
699 441.2004 880.3863 880.3926 -7.17 0 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 DYQQAQK + Deamidated (NQ)
1243 481.7188 961.4231 961.4141 9.40 0 3 1.9 +1Score > 18 indicates identity NGWENNVK + 2 Deamidated (NQ)
2571 589.7679 2355.0427 2355.0873 -18.9 1 3 2.4 +1Score > 19 indicates identity SLADHQSAAANDIRQMIQDNR + 2 Deamidated (NQ)
1571 508.7311 2030.8955 2030.9196 -11.9 1 3 1.5 +1Score > 17 indicates identity RSNIAEWFYTPGWMEK + Deamidated (NQ); Oxidation (M)
6288 886.9030 3543.5830 3543.6538 -20.0 1 3 2.6 +1Score > 19 indicates identity CGLVPVLAENYNKSDNCEDTPEAGYFAIAVVK + Deamidated (NQ)
886 454.7066 907.3986 907.3817 18.6 1 3 1.8 +1Score > 17 indicates identity ENMGRER + Deamidated (NQ); Oxidation (M)
5471 819.3723 1636.7301 1636.7119 11.1 1 3 0.61 +1Score > 21 indicates identity
Score > 13 indicates homology		 RMGELMAESHASMR + 2 Oxidation (M)
926 454.7066 1814.7972 1814.8100 -7.07 0 3 1.8 +1Score > 17 indicates identity VMQVSAMADQMLLDSK + Deamidated (NQ); 3 Oxidation (M)
2309 562.7557 1123.4968 1123.4968 0.031 1 3 2.1 +1Score > 18 indicates identity MREYPNGEK + Deamidated (NQ)
3927 697.8171 2787.2392 2787.2408 -0.57 0 3 2.7 +1Score > 19 indicates identity GFMVLGFPCNQFLEQEPGSDEEIK + Deamidated (NQ); Oxidation (M)
5028 778.8539 1555.6932 1555.7017 -5.46 1 3 2.2 +1Score > 18 indicates identity DKIYDFFMNYGK + Oxidation (M)
6593 900.4092 1798.8038 1798.8151 -6.27 0 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 VMQVSAMADQMLLDSK + Deamidated (NQ); 2 Oxidation (M)
6563 900.4092 3597.6076 3597.6697 -17.3 1 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 VKSWWVNAGEAFMIYSLAENFCSSNGYTLPR + Deamidated (NQ)
821 441.2004 1760.7727 1760.7424 17.2 1 3 0.77 +1Score > 20 indicates identity
Score > 14 indicates homology		 EDYAYSQQMQRDAR + Deamidated (NQ)
3850 684.3109 2733.2145 2733.2657 -18.7 0 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 LSLDDGGTNDFENLVLIENEPYHK + 2 Deamidated (NQ)
3956 697.8171 1393.6196 1393.6469 -19.6 0 3 2.7 +1Score > 19 indicates identity MVNLEPDMTISK + Deamidated (NQ); Oxidation (M)
4143 711.3232 1420.6319 1420.6445 -8.87 0 3 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 DYGLNLFGMYGR + Oxidation (M)
6280 886.9030 3543.5830 3543.5415 11.7 1 3 2.6 +1Score > 19 indicates identity TYNPNSLLPSQMQKCTCNSLHLAFDLCGGEA + 2 Deamidated (NQ); Oxidation (M)
6501 900.4092 3597.6076 3597.6558 -13.4 1 3 0.92 +1Score > 20 indicates identity
Score > 15 indicates homology		 MEAAQISQTLNTPQPMINAMLQQLESMGKAVR + 5 Deamidated (NQ); 4 Oxidation (M)
1773 522.2372 1563.6899 1563.6987 -5.64 0 2 2.7 +1Score > 19 indicates identity YVHQLDNNASVMR + 2 Deamidated (NQ); Oxidation (M)
4566 738.3355 2211.9847 2212.0106 -11.7 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 SYAPAQQSVAAGSEWTGMQVK + Deamidated (NQ); Oxidation (M)
420 414.1881 1652.7235 1652.7320 -5.18 1 2 2.6 +1Score > 19 indicates identity CVELVREMMGEQR + Deamidated (NQ); Oxidation (M)
1007 454.7066 1814.7972 1814.8100 -7.07 0 2 1.8 +1Score > 17 indicates identity VMQVSAMADQMLLDSK + Deamidated (NQ); 3 Oxidation (M)
2773 603.2741 2409.0673 2409.1080 -16.9 0 2 0.66 +1Score > 20 indicates identity
Score > 13 indicates homology		 EMLNFEPDTIISIGGGSPMDAAK + Deamidated (NQ); Oxidation (M)
5985 859.8907 1717.7669 1717.7763 -5.46 0 2 2.1 +1Score > 18 indicates identity EMLEHMASTLAQGER + Oxidation (M)
7242 954.4337 3813.7058 3813.7791 -19.2 0 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 HLNQLNALLESMDDGVISWDEQGNLQFINAQAAR + 4 Deamidated (NQ)
7524 980.1954 3916.7526 3916.7255 6.93 1 2 2.1 +1Score > 18 indicates identity NMGALGALSVDMTQANSTLPDDSQHDGQSVRFLYNK + 5 Deamidated (NQ); 2 Oxidation (M)
2151 549.2496 1096.4846 1096.4753 8.44 1 2 0.89 +1Score > 20 indicates identity
Score > 14 indicates homology		 GDARMMASSR + Oxidation (M)
2256 562.7557 2246.9936 2247.0075 -6.19 0 2 2.1 +1Score > 18 indicates identity SQMEIDFLELAMDEFIER + 2 Oxidation (M)
4089 711.3232 1420.6319 1420.6551 -16.3 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 QQMRDLMQQAR + Deamidated (NQ); Oxidation (M)
7518 980.1954 3916.7526 3916.7270 6.56 0 2 2.1 +1Score > 18 indicates identity LMPNVAAFNSDNPANPYMEGEVNLGMIWNGSAFVAR + 5 Deamidated (NQ); Oxidation (M)
1525 495.2250 1976.8708 1976.8898 -9.59 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 RMAEDLTEYLEEHGER
1906 535.7434 2138.9445 2138.9509 -2.96 0 2 1.8 +1Score > 18 indicates identity IYEMYSMTECIGLTCIR
3817 684.3109 1366.6073 1366.6187 -8.36 0 2 0.95 +1Score > 20 indicates identity
Score > 15 indicates homology		 EQTAWLSGTMAR + Deamidated (NQ); Oxidation (M)
840 441.2004 1320.5795 1320.6045 -18.9 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 TQIGSLSGGNQQK + 4 Deamidated (NQ)
2099 549.2496 2192.9692 2192.9512 8.22 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 RAHFDAGEFVQSWDDDAAR + Deamidated (NQ)
7191 954.4337 3813.7058 3813.6848 5.50 0 2 0.63 +1Score > 21 indicates identity
Score > 13 indicates homology		 LEAGMNLYGQEMDETISPLAANMGWTIAWEPADR + 2 Deamidated (NQ); 2 Oxidation (M)
7360 967.9399 2900.7978 2900.7864 3.93 1 2 2.7 +1Score > 19 indicates identity IVIIGLVMLLTAVVLNQLGQALIPVKR + Deamidated (NQ); Oxidation (M)
475 414.1881 826.3617 826.3612 0.69 1 2 2.7 +1Score > 19 indicates identity RMMAMR + 2 Oxidation (M)
2283 562.7557 1123.4968 1123.4968 0.031 1 2 2.1 +1Score > 18 indicates identity MREYPNGEK + Deamidated (NQ)
5831 846.3846 3381.5092 3381.5713 -18.3 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 IGNMLLGGLVYPLTCQPQDMLQAMEENRR + 3 Deamidated (NQ); 2 Oxidation (M)
6157 873.3969 2617.1689 2617.1611 2.99 1 2 0.61 +1Score > 22 indicates identity
Score > 13 indicates homology		 YNWGDGVCLAGSVDATNCLAAMKK + Deamidated (NQ); Oxidation (M)
897 454.7066 1814.7972 1814.8257 -15.7 0 2 1.8 +1Score > 17 indicates identity IYDSDSILSMHHEPR + Oxidation (M)
1206 481.7188 1922.8463 1922.8503 -2.07 0 2 2 +1Score > 18 indicates identity MALDHLDGFAMDVAQTR + Deamidated (NQ); 2 Oxidation (M)
1589 508.7311 2030.8955 2030.9037 -4.05 1 2 1.6 +1Score > 17 indicates identity VAAQHSMMPAETESEKER + Deamidated (NQ)
2080 549.2496 2192.9692 2192.9976 -13.0 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 MALNALDGMLARECNQQTR + 2 Deamidated (NQ)
6816 927.4214 3705.6567 3705.6279 7.76 0 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 WHNIEAMTDDTYFNIDFFVAPEVLMEGAQQR + 3 Deamidated (NQ); Oxidation (M)
309 400.6820 799.3495 799.3460 4.28 0 2 1.3 +1Score > 16 indicates identity ATDDHNK
4133 711.3232 2841.2639 2841.2871 -8.17 0 2 0.7 +1Score > 21 indicates identity
Score > 13 indicates homology		 TSLHFAMMETENNILMITGATPDSGK + Deamidated (NQ); 2 Oxidation (M)
4960 778.8539 3111.3864 3111.3866 -0.065 1 2 2.2 +1Score > 18 indicates identity EMADQVFTLNVLDNKNYTLSSDGGFSAR + 4 Deamidated (NQ); Oxidation (M)
940 454.7066 1814.7972 1814.8145 -9.56 0 2 1.8 +1Score > 17 indicates identity TEGATVFGYQVMDPER + Oxidation (M)
1520 495.2250 988.4354 988.4349 0.51 1 2 0.94 +1Score > 20 indicates identity
Score > 15 indicates homology		 VENASPKDE + Deamidated (NQ)
2401 576.2618 1150.5091 1150.5012 6.91 0 2 0.96 +1Score > 20 indicates identity
Score > 15 indicates homology		 MHHAMHDLK + 2 Oxidation (M)
385 414.1881 1652.7235 1652.7273 -2.32 0 2 2.7 +1Score > 19 indicates identity EMVSEMVANDLEAAK + Deamidated (NQ); Oxidation (M)
1909 535.7434 1069.4723 1069.4862 -13.0 1 2 1.9 +1Score > 18 indicates identity DAYREMAAK + Oxidation (M)
2589 589.7679 1177.5213 1177.5338 -10.6 0 2 2.5 +1Score > 19 indicates identity MEYQHWLR + Oxidation (M)
5449 819.3723 3273.4602 3273.4212 11.9 0 2 0.71 +1Score > 21 indicates identity
Score > 13 indicates homology		 MHATFMAKPYEEHAGSGMHIHISMQNNR + Deamidated (NQ); 3 Oxidation (M)
4455 738.3355 2211.9847 2212.0081 -10.6 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 STMMAGLSYAHFTQYGYLR + Oxidation (M)
4166 711.3232 2841.2639 2841.3023 -13.5 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 TIEATAPGCFEVFIHNDMEAAMKVK + Deamidated (NQ); 2 Oxidation (M)
6377 886.9030 3543.5830 3543.6287 -12.9 1 2 2.7 +1Score > 19 indicates identity QQEMNTQTGRFAADMQVSLVNDGPVTFWLQV + 2 Deamidated (NQ); 2 Oxidation (M)
6869 927.4214 3705.6567 3705.7020 -12.2 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 QSVLEMSDVNERLEYLMAMMESEIDLLQVEK + 2 Deamidated (NQ); 2 Oxidation (M)
4092 711.3232 2841.2639 2841.3003 -12.8 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 AKNGDNEYMAWDMTLGWIIWQQR + Oxidation (M)
4781 765.3478 3057.3620 3057.3994 -12.2 1 2 0.88 +1Score > 21 indicates identity
Score > 14 indicates homology		 FASYLIAAVQQATNGHCAICETMAQKR + 3 Deamidated (NQ); Oxidation (M)
6376 886.9030 3543.5830 3543.6538 -20.0 1 2 2.7 +1Score > 19 indicates identity CGLVPVLAENYNKSDNCEDTPEAGYFAIAVVK + Deamidated (NQ)
6473 900.4092 1798.8038 1798.8156 -6.53 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 IDINHDIANVTEQCR + 2 Deamidated (NQ)
815 441.2004 880.3863 880.3927 -7.21 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 TDFDQVR + Deamidated (NQ)
839 441.2004 1320.5795 1320.6054 -19.6 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 SQLPGMVEDAMK + Oxidation (M)
1716 522.2372 1563.6899 1563.7173 -17.5 1 2 2.8 +1Score > 19 indicates identity IDSMYNLRMYSR + Oxidation (M)
1477 495.2250 1482.6531 1482.6443 5.96 0 2 0.88 +1Score > 20 indicates identity
Score > 14 indicates homology		 NNMTIGIGAGQMSR + 2 Deamidated (NQ); 2 Oxidation (M)
7292 967.9399 3867.7304 3867.7243 1.58 1 2 2.7 +1Score > 19 indicates identity LNDYMMTELIGANNNHVVPSTPQSWAEYSDPKSR + 4 Deamidated (NQ)
1469 495.2250 1976.8708 1976.8938 -11.7 0 2 0.76 +1Score > 20 indicates identity
Score > 14 indicates homology		 GQGFFQVMLPDGSSAYTR + Deamidated (NQ); Oxidation (M)
2602 589.7679 1177.5213 1177.5186 2.32 0 2 2.5 +1Score > 19 indicates identity CQDINFPER
3757 684.3109 2049.9109 2049.9491 -18.6 0 2 0.73 +1Score > 20 indicates identity
Score > 13 indicates homology		 ETNIVEVENFVQQSEER + Deamidated (NQ)
5977 859.8907 3435.5339 3435.5929 -17.2 1 2 2.2 +1Score > 18 indicates identity RQMLNEHYDVTTAAYAVGYESYPISVGNIR + 3 Deamidated (NQ); Oxidation (M)
1472 495.2250 1482.6531 1482.6443 5.96 1 2 0.99 +1Score > 20 indicates identity
Score > 15 indicates homology		 MSGDNGMTEEKLR + Oxidation (M)
3628 670.8048 2679.1901 2679.1983 -3.06 1 2 2.7 +1Score > 19 indicates identity TQLDSAGYRHVDQVMEHGEYATR + Deamidated (NQ); Oxidation (M)
6263 873.3969 2617.1689 2617.1954 -10.1 1 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 QAHWNMRGANFIAVHEMLDGFR + 2 Deamidated (NQ); Oxidation (M)
126 387.1759 1544.6744 1544.6994 -16.2 0 2 1.4 +1Score > 16 indicates identity EQNEPVAQVSQWK + 3 Deamidated (NQ)
1592 508.7311 1015.4477 1015.4570 -9.15 0 2 1.6 +1Score > 17 indicates identity TINNAPDNR + 2 Deamidated (NQ)
3227 630.2864 1887.8373 1887.8275 5.18 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 GENPLVDSYSAFFDNGR + Deamidated (NQ)
304 400.6820 1598.6989 1598.7186 -12.3 1 2 1.3 +1Score > 16 indicates identity GGQHSGGNFKNDPQR + Deamidated (NQ)
1792 522.2372 2084.9199 2084.9109 4.29 0 2 2.9 +1Score > 19 indicates identity LDELCQDAAGVNFNGFASR + 2 Deamidated (NQ)
1839 522.2372 2084.9199 2084.9287 -4.22 0 2 2.9 +1Score > 19 indicates identity QTSLNGFYQDNGGDADLLR + 2 Deamidated (NQ)
5800 846.3846 2536.1319 2536.1110 8.23 1 2 0.98 +1Score > 20 indicates identity
Score > 15 indicates homology		 MAQQSPYSAAMAEQRHQEWLR + 3 Deamidated (NQ); Oxidation (M)
5154 792.3600 2374.0583 2374.0130 19.1 0 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 LQLSMDPMLDMMGMQMLMEK + 2 Deamidated (NQ)
5701 832.8785 3327.4848 3327.5162 -9.44 1 2 2.8 +1Score > 19 indicates identity IDTNQCIDSKNIDIYTPEQIIAMGWQNK + 4 Deamidated (NQ); Oxidation (M)
5801 846.3846 1690.7546 1690.7847 -17.8 0 2 0.84 +1Score > 20 indicates identity
Score > 14 indicates homology		 FKPMPQYYGGALMR + Deamidated (NQ); 2 Oxidation (M)
6244 873.3969 1744.7793 1744.7864 -4.08 0 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 ATHTDSVSSEQVDNVR + Deamidated (NQ)
7147 954.4337 1906.8529 1906.8765 -12.4 0 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 MAMSEQPQPVAGAAASTTK + 2 Oxidation (M)
963 454.7066 907.3986 907.4069 -9.16 0 2 1.9 +1Score > 17 indicates identity MNNSEGLK + Oxidation (M)
977 454.7066 907.3986 907.4069 -9.16 0 2 1.9 +1Score > 17 indicates identity MNNSEGLK + Oxidation (M)
1123 468.2127 1868.8217 1868.8496 -14.9 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 MSKSIGNTVSPQDVMNK + 2 Deamidated (NQ); 2 Oxidation (M)
1607 508.7311 2030.8955 2030.9037 -4.05 1 2 1.6 +1Score > 17 indicates identity VAAQHSMMPAETESEKER + Deamidated (NQ)
4688 751.8416 3003.3374 3003.3403 -1.00 0 2 2.6 +1Score > 19 indicates identity QEPYENVTLDVEEQHQGSVMQALGER + 2 Deamidated (NQ); Oxidation (M)
938 454.7066 1814.7972 1814.8145 -9.56 0 2 1.9 +1Score > 17 indicates identity TEGATVFGYQVMDPER + Oxidation (M)
Page: Previous 1 …5 6 7 8 9 10 11 12 13 14 15 … 76 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/