MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 4 Dec 2025 at 15:28:39 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1–100 (out of 7566)


Page: 1 2 3 4 5 6  76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
357 414.1881 1239.5426 1239.5554 -10.3 0 18 0.07 +1Score > 19 indicates identity DQYAGAVETMR
7262 954.4337 1906.8529 1906.8400 6.74 1 18 0.12 +1Score > 21 indicates identity NQRENMLVVEDICQR + 4 Deamidated (NQ)
1903 535.7434 2138.9445 2138.9716 -12.7 1 18 0.055 +1Score > 18 indicates identity ITGSQVKNNGYVQDTNNQR + 4 Deamidated (NQ)
423 414.1881 1239.5426 1239.5661 -19.0 0 18 0.083 +1Score > 19 indicates identity SPMELMTMLR + 2 Oxidation (M)
365 414.1881 1239.5426 1239.5554 -10.3 0 16 0.11 +1Score > 19 indicates identity DQYAGAVETMR
5152 792.3600 2374.0583 2374.0470 4.75 0 16 0.19 +1Score > 21 indicates identity AQMEQQFSANFFGAHQLTMR + Deamidated (NQ); 2 Oxidation (M)
315 400.6820 1598.6989 1598.7259 -16.9 1 15 0.068 +1Score > 16 indicates identity AWAQAAQCPPDRAR + 2 Deamidated (NQ)
2372 562.7557 1123.4968 1123.5179 -18.8 0 15 0.12 +1Score > 18 indicates identity SASLSDIEMR + Oxidation (M)
1420 495.2250 1482.6531 1482.6660 -8.73 0 15 0.13 +1Score > 20 indicates identity
Score > 18 indicates homology
MYGDDLLGDEIAR + Oxidation (M)
779 441.2004 1320.5795 1320.6020 -17.0 0 15 0.19 +1Score > 20 indicates identity DGIPLMEEDFR
757 441.2004 1320.5795 1320.6020 -17.0 0 15 0.15 +1Score > 20 indicates identity
Score > 19 indicates homology
DGIPLMEEDFR
211 400.6820 799.3495 799.3460 4.28 0 15 0.079 +1Score > 16 indicates identity ATDDHNK
453 414.1881 1652.7235 1652.7253 -1.09 0 14 0.17 +1Score > 19 indicates identity CWQEEAYAEAQLR
5120 792.3600 2374.0583 2374.0482 4.27 0 14 0.068 +1Score > 21 indicates identity
Score > 15 indicates homology
QENISVTDSYSTGNAAQAMLEK + 2 Deamidated (NQ); Oxidation (M)
2092 549.2496 1096.4846 1096.4978 -12.0 0 14 0.12 +1Score > 20 indicates identity
Score > 17 indicates homology
YYGYTGAFR
2770 603.2741 2409.0673 2409.0723 -2.04 1 14 0.26 +1Score > 20 indicates identity ACDLGLAMQMSNIARDVGEDAR + Deamidated (NQ); Oxidation (M)
835 441.2004 1760.7727 1760.7940 -12.1 1 14 0.19 +1Score > 20 indicates identity
Score > 19 indicates homology
EYTWANLMERNYR + Oxidation (M)
3032 616.7802 2463.0917 2463.0521 16.1 0 13 0.17 +1Score > 18 indicates identity TSDVHDATDGVTETALDDEQSTR + Deamidated (NQ)
558 427.6943 853.3741 853.3600 16.5 0 13 0.099 +1Score > 16 indicates identity MTSSAGQR + Deamidated (NQ); Oxidation (M)
3302 643.7925 2571.1411 2571.1322 3.43 0 13 0.18 +1Score > 18 indicates identity LPFNNGQETNELELMNATFDEK + 2 Deamidated (NQ); Oxidation (M)
781 441.2004 1320.5795 1320.6058 -19.9 1 13 0.28 +1Score > 20 indicates identity DNNRVGFAEAAR + 2 Deamidated (NQ)
5469 819.3723 3273.4602 3273.5169 -17.3 0 13 0.36 +1Score > 21 indicates identity MDAFIQYGIVAGVQAMQDSGLEITEENATR + Deamidated (NQ); Oxidation (M)
152 387.1759 1544.6744 1544.7028 -18.4 0 13 0.13 +1Score > 16 indicates identity HAEQENMTLTELK + 2 Deamidated (NQ)
2100 549.2496 1096.4846 1096.4753 8.44 1 12 0.16 +1Score > 20 indicates identity
Score > 17 indicates homology
GDARMMASSR + Oxidation (M)
1413 495.2250 1482.6531 1482.6806 -18.6 0 12 0.31 +1Score > 20 indicates identity MVNSGTEATMSAIR + Oxidation (M)
268 400.6820 1598.6989 1598.7186 -12.3 1 12 0.13 +1Score > 16 indicates identity GGQHSGGNFKNDPQR + Deamidated (NQ)
425 414.1881 1239.5426 1239.5661 -19.0 0 12 0.29 +1Score > 19 indicates identity SPMELMTMLR + 2 Oxidation (M)
1567 508.7311 1015.4477 1015.4611 -13.1 0 12 0.17 +1Score > 17 indicates identity YYDAETVR
1781 522.2372 2084.9199 2084.9109 4.29 0 12 0.3 +1Score > 19 indicates identity LDELCQDAAGVNFNGFASR + 2 Deamidated (NQ)
915 454.7066 907.3986 907.3891 10.4 0 12 0.2 +1Score > 17 indicates identity DMAMNQAK
5807 846.3846 1690.7546 1690.7369 10.5 1 12 0.36 +1Score > 20 indicates identity QYYMNQQRTQSAR + 2 Deamidated (NQ); Oxidation (M)
362 414.1881 1239.5426 1239.5661 -19.0 0 12 0.29 +1Score > 19 indicates identity SPMELMTMLR + 2 Oxidation (M)
807 441.2004 1760.7727 1760.7940 -12.1 1 12 0.35 +1Score > 20 indicates identity EYTWANLMERNYR + Oxidation (M)
557 427.6943 853.3741 853.3600 16.5 0 12 0.14 +1Score > 16 indicates identity MTSSAGQR + Deamidated (NQ); Oxidation (M)
776 441.2004 1320.5795 1320.6058 -19.9 1 12 0.35 +1Score > 20 indicates identity DNNRVGFAEAAR + 2 Deamidated (NQ)
1835 522.2372 1563.6899 1563.7205 -19.6 0 12 0.31 +1Score > 19 indicates identity AADAAFAEWGQTTPK + Deamidated (NQ)
1599 508.7311 1015.4477 1015.4458 1.91 0 12 0.18 +1Score > 17 indicates identity GNNQPDIQK + 3 Deamidated (NQ)
399 414.1881 1652.7235 1652.7273 -2.32 0 12 0.3 +1Score > 19 indicates identity EMVSEMVANDLEAAK + Deamidated (NQ); Oxidation (M)
2078 549.2496 1096.4846 1096.4753 8.44 1 12 0.17 +1Score > 20 indicates identity
Score > 16 indicates homology
GDARMMASSR + Oxidation (M)
102 387.1759 1544.6744 1544.6817 -4.72 0 12 0.16 +1Score > 16 indicates identity FEGCLEYETQLR + Deamidated (NQ)
1609 508.7311 2030.8955 2030.9102 -7.27 0 12 0.18 +1Score > 17 indicates identity NMNTPPGSTQENEIDLLR + 3 Deamidated (NQ)
2266 562.7557 2246.9936 2247.0187 -11.2 0 12 0.25 +1Score > 18 indicates identity ANQMRPMVVQSSEDFYLAK + 2 Deamidated (NQ); 2 Oxidation (M)
2648 589.7679 2355.0427 2355.0181 10.4 1 12 0.29 +1Score > 19 indicates identity DIHPKYEEITASCSCGNVMK + Deamidated (NQ); Oxidation (M)
7571 980.1954 2937.5645 2937.6190 -18.6 1 12 0.26 +1Score > 18 indicates identity MNSLQILSFVGFTLLVAVITWWKVR + Deamidated (NQ); Oxidation (M)
5466 819.3723 1636.7301 1636.7185 7.07 0 12 0.48 +1Score > 21 indicates identity VGGLSVMCEDAEAAGR + Oxidation (M)
5825 846.3846 1690.7546 1690.7369 10.5 1 12 0.4 +1Score > 20 indicates identity QYYMNQQRTQSAR + 2 Deamidated (NQ); Oxidation (M)
1798 522.2372 1563.6899 1563.6909 -0.61 1 12 0.34 +1Score > 19 indicates identity ICSPQNNTGAPMKK + 3 Deamidated (NQ); Oxidation (M)
1185 468.2127 934.4109 934.4178 -7.41 0 12 0.36 +1Score > 20 indicates identity NAALNEMR + Deamidated (NQ); Oxidation (M)
119 387.1759 1544.6744 1544.6817 -4.72 0 11 0.18 +1Score > 16 indicates identity FEGCLEYETQLR + Deamidated (NQ)
2641 589.7679 2355.0427 2355.0181 10.4 1 11 0.32 +1Score > 19 indicates identity DIHPKYEEITASCSCGNVMK + Deamidated (NQ); Oxidation (M)
2934 616.7802 1231.5459 1231.5680 -18.0 0 11 0.27 +1Score > 18 indicates identity TDAEQAQELAR + Deamidated (NQ)
1097 468.2127 1401.6163 1401.6194 -2.24 0 11 0.38 +1Score > 20 indicates identity TLPPGCEGEEASR
2777 603.2741 1806.8005 1806.8314 -17.1 0 11 0.47 +1Score > 20 indicates identity TVAAEMPAMQCLQLAR + 2 Deamidated (NQ); Oxidation (M)
274 400.6820 1598.6989 1598.7186 -12.3 1 11 0.17 +1Score > 16 indicates identity GGQHSGGNFKNDPQR + Deamidated (NQ)
273 400.6820 1598.6989 1598.7186 -12.3 1 11 0.17 +1Score > 16 indicates identity GGQHSGGNFKNDPQR + Deamidated (NQ)
1250 481.7188 961.4231 961.4063 17.6 0 11 0.27 +1Score > 18 indicates identity METPQPDK + Deamidated (NQ); Oxidation (M)
554 427.6943 853.3741 853.3640 11.8 0 11 0.17 +1Score > 16 indicates identity GQYPMNK + Deamidated (NQ); Oxidation (M)
400 414.1881 1652.7235 1652.7253 -1.09 0 11 0.37 +1Score > 19 indicates identity CWQEEAYAEAQLR
556 427.6943 853.3741 853.3600 16.5 0 11 0.17 +1Score > 16 indicates identity MTSSAGQR + Deamidated (NQ); Oxidation (M)
3082 630.2864 1258.5582 1258.5621 -3.06 0 11 0.41 +1Score > 20 indicates identity ISMMPGMPSHR + Oxidation (M)
6193 873.3969 2617.1689 2617.2152 -17.7 1 11 0.68 +1Score > 22 indicates identity FVGAGGMEAARAVSEEMAEIYLER + 2 Oxidation (M)
111 387.1759 1158.5058 1158.5267 -18.0 0 11 0.2 +1Score > 16 indicates identity FMAQYQELK + 2 Deamidated (NQ)
1241 481.7188 961.4231 961.4063 17.6 0 11 0.3 +1Score > 18 indicates identity METPQPDK + Deamidated (NQ); Oxidation (M)
374 414.1881 1652.7235 1652.7253 -1.09 0 11 0.4 +1Score > 19 indicates identity CWQEEAYAEAQLR
1776 522.2372 2084.9199 2084.9355 -7.47 1 11 0.41 -1Score > 19 indicates identity MTSVGSQDTTGPMTRDELK + 2 Oxidation (M)
2127 549.2496 1096.4846 1096.4753 8.44 1 11 0.19 +1Score > 20 indicates identity
Score > 16 indicates homology
GDARMMASSR + Oxidation (M)
3013 616.7802 2463.0917 2463.1051 -5.42 0 11 0.32 +1Score > 18 indicates identity VDGNLNSFELTGQAGADNHFNSR + Deamidated (NQ)
3097 630.2864 1887.8373 1887.8461 -4.68 0 10 0.2 +1Score > 20 indicates identity
Score > 16 indicates homology
AQAAQPDQLMSDYFFR + Deamidated (NQ)
1591 508.7311 1015.4477 1015.4393 8.31 0 10 0.25 +1Score > 17 indicates identity GNNHSCVVK + 2 Deamidated (NQ)
796 441.2004 1320.5795 1320.6058 -19.9 1 10 0.5 +1Score > 20 indicates identity DNNRVGFAEAAR + 2 Deamidated (NQ)
658 427.6943 853.3741 853.3786 -5.32 1 10 0.2 +1Score > 16 indicates identity RGDMTMK + Oxidation (M)
3710 670.8048 1339.5951 1339.6125 -13.0 1 10 0.43 +1Score > 19 indicates identity AANQAFMMERR + Oxidation (M)
1424 495.2250 1482.6531 1482.6820 -19.5 1 10 0.49 +1Score > 20 indicates identity GYDRAMGARPMAR + 2 Oxidation (M)
312 400.6820 1598.6989 1598.7001 -0.74 0 10 0.21 +1Score > 16 indicates identity FANSLFVNNWDNR + 3 Deamidated (NQ)
961 454.7066 1814.7972 1814.7879 5.09 1 10 0.29 +1Score > 17 indicates identity KQQLINQANDYMNSK + 5 Deamidated (NQ); Oxidation (M)
2497 576.2618 1150.5091 1150.5288 -17.1 0 10 0.15 +1Score > 20 indicates identity
Score > 15 indicates homology
TGDIMTIGGNR + Deamidated (NQ); Oxidation (M)
1809 522.2372 2084.9199 2084.9287 -4.22 0 10 0.46 +1Score > 19 indicates identity QTSLNGFYQDNGGDADLLR + 2 Deamidated (NQ)
1242 481.7188 961.4231 961.4141 9.40 0 10 0.33 +1Score > 18 indicates identity NGWENNVK + 2 Deamidated (NQ)
2416 576.2618 1725.7637 1725.7668 -1.83 1 10 0.28 +1Score > 20 indicates identity
Score > 17 indicates homology
FETDKWDVMDADVR
496 414.1881 1652.7235 1652.7087 8.95 0 10 0.45 +1Score > 19 indicates identity NMNNTEVSNLVVNGK + 5 Deamidated (NQ); Oxidation (M)
1775 522.2372 2084.9199 2084.9176 1.07 1 10 0.46 +1Score > 19 indicates identity MTTLNCSGQCRLQAVEAK + 3 Deamidated (NQ); Oxidation (M)
1004 454.7066 907.3986 907.3957 3.23 0 10 0.3 +1Score > 17 indicates identity QMQNELK + 2 Deamidated (NQ); Oxidation (M)
1490 495.2250 988.4354 988.4219 13.7 0 10 0.51 +1Score > 20 indicates identity GNHEVMMR + Oxidation (M)
1583 508.7311 1015.4477 1015.4458 1.91 0 10 0.27 +1Score > 17 indicates identity GNNQPDIQK + 3 Deamidated (NQ)
3206 630.2864 2517.1164 2517.1289 -4.96 0 10 0.51 +1Score > 20 indicates identity GSAVNNGGAAQGMTTPDAQAQEAVLR + 4 Deamidated (NQ)
1816 522.2372 1563.6899 1563.6736 10.4 1 10 0.48 +1Score > 19 indicates identity EGDTLDCRQWQR + Deamidated (NQ)
248 400.6820 1598.6989 1598.7186 -12.3 1 10 0.23 +1Score > 16 indicates identity GGQHSGGNFKNDPQR + Deamidated (NQ)
2749 603.2741 1204.5337 1204.5360 -1.95 0 10 0.16 +1Score > 20 indicates identity
Score > 15 indicates homology
ENDTLHDAYK
465 414.1881 826.3617 826.3491 15.3 0 10 0.48 +1Score > 19 indicates identity MTESTSR + Oxidation (M)
1453 495.2250 1482.6531 1482.6409 8.26 1 10 0.54 +1Score > 20 indicates identity NKQNDLQAMHHK + 4 Deamidated (NQ); Oxidation (M)
6968 940.9276 3759.6811 3759.6790 0.56 1 10 0.49 +1Score > 19 indicates identity VESTNSYVLCHLFDQPTHTSAMFICDRCGAVK + Deamidated (NQ); Oxidation (M)
2668 589.7679 2355.0427 2355.0181 10.4 1 10 0.46 +1Score > 19 indicates identity DIHPKYEEITASCSCGNVMK + Deamidated (NQ); Oxidation (M)
4102 711.3232 1420.6319 1420.6504 -13.0 0 10 0.27 +1Score > 21 indicates identity
Score > 17 indicates homology
ENITNLDACITR + 2 Deamidated (NQ)
439 414.1881 1239.5426 1239.5190 19.1 0 10 0.5 +1Score > 19 indicates identity QNDLQAMHHK + 3 Deamidated (NQ); Oxidation (M)
122 387.1759 1544.6744 1544.6705 2.55 0 10 0.26 +1Score > 16 indicates identity QDDAMVAFQNFIK + 3 Deamidated (NQ); Oxidation (M)
397 414.1881 1239.5426 1239.5553 -10.3 1 10 0.5 +1Score > 19 indicates identity QKMAENNGGYK + Deamidated (NQ)
169 387.1759 772.3372 772.3351 2.67 0 10 0.26 +1Score > 16 indicates identity AQGEDPR + Deamidated (NQ)
1468 495.2250 988.4354 988.4219 13.7 0 10 0.19 +1Score > 20 indicates identity
Score > 15 indicates homology
GNHEVMMR + Oxidation (M)
5118 792.3600 2374.0583 2374.0482 4.27 0 10 0.16 +1Score > 21 indicates identity
Score > 14 indicates homology
QENISVTDSYSTGNAAQAMLEK + 2 Deamidated (NQ); Oxidation (M)
748 441.2004 880.3863 880.3821 4.81 1 10 0.6 +1Score > 20 indicates identity NRSSTCR + Deamidated (NQ)
Page: 1 2 3 4 5 6  76 Next 

Not what you expected? Try the select summary.