MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Andy2
MS data file : PRT1311_JBEI_2.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 8 Sep 2025 at 17:18:13 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,460

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 201–300 (out of 4256)

Page: Previous 1 2 3 4 5 6 7 8 … 43 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
4188 818.7483 2453.2231 2453.2696 -19.0 1 1 2.9 +1Score > 18 indicates identity VVSSQIITGIDGHQSQLINRMR + 2 Deamidated (NQ)
3439 338.4850 1012.4332 1012.4284 4.75 1 1 1.9 +1Score > 17 indicates identity AQAQEMYR + Deamidated (NQ); Oxidation (M)
3310 422.2713 842.5280 842.5113 19.9 1 1 2.1 +1Score > 17 indicates identity IIEQVLK + Deamidated (NQ)
3406 491.2340 980.4534 980.4702 -17.1 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 ELYTDVIE
4207 831.0939 2490.2599 2490.2272 13.1 1 1 2.7 +1Score > 18 indicates identity ASGTGNMKLALNGALTVGTLDGANVE + Deamidated (NQ); Oxidation (M)
3837 854.3778 1706.7410 1706.7426 -0.90 1 1 2.2 +1Score > 17 indicates identity IEIPGCSLCMGNQAR + 2 Deamidated (NQ)
3343 450.2696 898.5246 898.5348 -11.3 1 1 3.3 +1Score > 19 indicates identity RDVQLLR
3915 463.7549 1850.9905 1851.0036 -7.10 1 1 2.4 +1Score > 17 indicates identity AAHEGVIGQILTMNLLR + Oxidation (M)
3969 1030.0222 2058.0298 2058.0190 5.25 0 1 3.9 +1Score > 19 indicates identity ANAATGNLNILLPMVTSLDE + 2 Deamidated (NQ)
3297 412.7559 823.4972 823.5028 -6.73 1 1 0.8 +1Score > 13 indicates identity LHSKIAR
3643 421.2070 1260.5992 1260.5955 2.95 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 GLGEMNPMQLR + Oxidation (M)
4194 821.7585 2462.2537 2462.2216 13.0 1 1 2.7 +1Score > 18 indicates identity SEPLPLAFAVQDGASYAGAILKDE + Deamidated (NQ)
3938 967.0093 1932.0040 1931.9961 4.10 1 1 3.1 +1Score > 18 indicates identity VMRDMVYNLPVLTPPR + 2 Oxidation (M)
4185 818.4149 2452.2229 2452.1870 14.6 1 1 3.2 +1Score > 18 indicates identity LAQIDQHIADGELNLWQASSDK + Deamidated (NQ)
3944 967.5126 1933.0106 1932.9801 15.8 1 1 3.1 +1Score > 18 indicates identity VMRDMVYNLPVLTPPR + Deamidated (NQ); 2 Oxidation (M)
3822 558.6407 1672.9003 1672.8784 13.1 1 1 3.5 +1Score > 19 indicates identity DYSHLTNDLVGAIKK
3658 638.3022 1274.5898 1274.5786 8.86 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 CQNQQGNLRR + 2 Deamidated (NQ)
3730 475.2241 1422.6505 1422.6595 -6.36 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 ANCAMIGGSLSVAR + Deamidated (NQ); Oxidation (M)
3857 582.2899 1743.8479 1743.8502 -1.31 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 TNGIYAVCSAHPLVLE + Deamidated (NQ)
3451 515.7946 1029.5746 1029.5818 -6.99 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 ISAAVSIDVR
3997 720.0706 2157.1900 2157.1946 -2.14 1 1 1.2 +1Score > 14 indicates identity FAALTAQNFISDLLVKHLR + Deamidated (NQ)
3851 864.9771 1727.9396 1727.9570 -10.1 1 1 3 +1Score > 18 indicates identity VASRGITVNVVAPGFIE
3854 433.7384 1730.9245 1730.9059 10.8 1 1 3.6 +1Score > 19 indicates identity VEQALMVTIAGIAAGMR + Deamidated (NQ)
3875 590.6463 1768.9171 1768.9141 1.66 1 1 4 +1Score > 19 indicates identity LATHAGQIMDRDALLK + Deamidated (NQ); Oxidation (M)
4083 761.7518 2282.2336 2282.2596 -11.4 0 1 1.7 +1Score > 16 indicates identity INGQVLPFLQPIQLSAMVLAK + 3 Deamidated (NQ)
4104 767.4014 2299.1824 2299.1644 7.82 1 1 3.1 +1Score > 18 indicates identity LRSWFAQHNASLVVMRPDR + Deamidated (NQ); Oxidation (M)
3775 499.6019 1495.7839 1495.7922 -5.57 0 0 4.1 +1Score > 19 indicates identity VQPINTALIPNWK + 3 Deamidated (NQ)
3634 628.8299 1255.6452 1255.6520 -5.40 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 RQQALQQALAE + Deamidated (NQ)
4200 616.5732 2462.2637 2462.2708 -2.87 0 0 2.8 +1Score > 17 indicates identity APFIWAALSLYWAQMANLIPGK + 2 Deamidated (NQ)
3746 480.5464 1438.6174 1438.6398 -15.6 1 0 2.8 +1Score > 17 indicates identity YVGQPQVRSQME + 2 Deamidated (NQ); Oxidation (M)
3716 693.8525 1385.6904 1385.6787 8.50 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 DAALITGDTPGAER
3796 523.6086 1567.8040 1567.8082 -2.69 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 FLMRQQGLAWFR + Oxidation (M)
3558 592.3127 1182.6108 1182.5880 19.3 1 0 4.4 +1Score > 19 indicates identity RPPEDAIAVSE
3173 321.1916 640.3686 640.3656 4.71 0 0 1.8 +1Score > 16 indicates identity APNIAR
3561 594.3158 1186.6170 1186.6193 -1.93 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 SDLNIQLLDR + Deamidated (NQ)
4051 554.5600 2214.2109 2214.1896 9.62 0 0 1.2 +1Score > 14 indicates identity LIFNTQTGPAIVASLIDLGDR + Deamidated (NQ)
3827 565.9946 1694.9620 1694.9468 8.97 1 0 1.6 +1Score > 15 indicates identity NIAGHLKDAQIFIQK
3852 577.6478 1729.9216 1729.8900 18.3 1 0 3.8 +1Score > 19 indicates identity KNPNFPNFVGTNKPR + Deamidated (NQ)
4219 835.4421 2503.3045 2503.2707 13.5 1 0 3.4 +1Score > 18 indicates identity YSLPHVAELALGGTAVGTGLNTHPE
3462 347.8442 1040.5108 1040.4961 14.1 0 0 4 +1Score > 19 indicates identity AITDFMTAR + Oxidation (M)
3672 647.8419 1293.6692 1293.6816 -9.57 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 LADIPSVPPSLGE
4027 728.0442 2181.1108 2181.1389 -12.9 1 0 3.4 +1Score > 18 indicates identity LGPSQLAQRAVDLISNVAGDR + 2 Deamidated (NQ)
3293 410.2555 818.4964 818.5014 -6.07 0 0 0.92 +1Score > 13 indicates identity AVTIFIR
3589 405.8778 1214.6116 1214.5972 11.9 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 EQWVEPLWK + Deamidated (NQ)
3514 548.3018 1094.5890 1094.5720 15.6 1 0 2.9 +1Score > 17 indicates identity RIADPGLQPE
3917 619.6645 1855.9717 1855.9536 9.75 1 0 3.2 +1Score > 18 indicates identity LVIMLTLGANEGMNHVK + Deamidated (NQ); Oxidation (M)
3546 575.8239 1149.6332 1149.6328 0.38 1 0 2.4 +1Score > 17 indicates identity ALYDRMLIR
3926 626.0023 1874.9851 1874.9666 9.88 1 0 3.6 +1Score > 18 indicates identity LLAFDPYPSAAALELGVE
4026 728.0433 2181.1081 2181.0657 19.4 1 0 3.6 +1Score > 18 indicates identity NSMKSAIDLGIAMQLTNISR + 3 Deamidated (NQ); Oxidation (M)
3582 404.5894 1210.7464 1210.7471 -0.60 1 0 0.94 +1Score > 13 indicates identity IPLIKLMINR + Deamidated (NQ)
3645 421.8859 1262.6359 1262.6255 8.21 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 FEVAADLNTQR
4055 742.7086 2225.1040 2225.0616 19.1 1 0 4.2 +1Score > 19 indicates identity LFYLFFQHVEIHQTMSGE
4158 602.0967 2404.3577 2404.3186 16.2 1 0 0.94 +1Score > 13 indicates identity QTSGVQQQIRQALSALPLPVNR + Deamidated (NQ)
3323 435.7568 869.4990 869.4858 15.2 0 0 2 +1Score > 16 indicates identity VAQVQPVK + 2 Deamidated (NQ)
3428 335.1911 1002.5515 1002.5597 -8.20 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 IQLAKSLTE + Deamidated (NQ)
4079 571.3156 2281.2333 2281.2008 14.3 1 0 2.1 +1Score > 16 indicates identity VAFTWQGGEPTLLGLAFYRR
4182 816.7665 2447.2777 2447.2921 -5.89 1 0 3 +1Score > 17 indicates identity NLPKAHIVATNPPFGSAAGTNITR + Deamidated (NQ)
3329 436.7845 871.5544 871.5379 19.0 0 0 1.3 +1Score > 14 indicates identity IIGVQTLK + Deamidated (NQ)
4295 942.1248 2823.3526 2823.3651 -4.45 1 0 3.3 +1Score > 18 indicates identity LQLNQWTIFYEPRALCWILMPE + 3 Deamidated (NQ)
4439 1075.2454 6445.4287 6445.4739 -7.00 0 0 0.96 +1Score > 13 indicates identity GAAGFGAPVAITGALLVGLGFKPLYAAGLCLIANTAPVAFGALGVPILVAGQVTGIDPFHIGAMAGR + 2 Deamidated (NQ); Oxidation (M)
3725 705.3381 1408.6616 1408.6769 -10.8 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 RFMIDIDQAQR + Deamidated (NQ); Oxidation (M)
4031 1091.5653 2181.1160 2181.0776 17.6 1 0 3.4 +1Score > 18 indicates identity IGGRIVPFTYQLQMGDQIE + Deamidated (NQ); Oxidation (M)
4126 586.3006 2341.1733 2341.1914 -7.72 1 0 4.4 +1Score > 19 indicates identity VHLFSATLRDNLLLASPGSSDE
3444 511.2552 1020.4958 1020.4763 19.1 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 ELQYQPNK + 2 Deamidated (NQ)
3966 681.9893 2042.9461 2042.9633 -8.41 1 0 4 +1Score > 19 indicates identity VHAGVRSAMIDGSHFPFAE + Oxidation (M)
3585 404.5897 1210.7473 1210.7471 0.14 1 0 0.97 +1Score > 13 indicates identity IPLIKLMINR + Deamidated (NQ)
3432 504.2467 1006.4788 1006.4607 18.0 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 QIDLFGNAE + Deamidated (NQ)
3773 374.7013 1494.7761 1494.7640 8.11 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 NVTFTTINMPLVK + 2 Deamidated (NQ); Oxidation (M)
4000 540.3051 2157.1913 2157.1827 3.99 1 0 1.3 +1Score > 14 indicates identity DILQMQQLLSALIQRLTR + 2 Deamidated (NQ); Oxidation (M)
3654 424.2196 1269.6370 1269.6394 -1.88 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 GWSEAYGLFLK
4118 773.3794 2317.1164 2317.1073 3.90 1 0 4 +1Score > 19 indicates identity ALDIRPDNFVLIATNNQDRE + 4 Deamidated (NQ)
1 300.0927 299.0854
2 300.2093 299.2020
3 301.0868 300.0795
4 301.0873 300.0800
5 301.0877 300.0804
6 301.0941 300.0868
7 301.1046 300.0973
8 301.1046 300.0973
9 301.1047 300.0974
10 301.1053 300.0980
11 301.1053 300.0980
12 301.1054 300.0981
13 301.1056 300.0983
14 301.1057 300.0984
15 301.1159 300.1086
16 301.1159 300.1086
17 301.1160 300.1087
18 301.1163 300.1090
19 301.1233 300.1160
20 301.1418 300.1345
21 301.1419 300.1346
22 301.1420 300.1347
23 301.1421 300.1348
24 301.1423 300.1350
25 301.1423 300.1350
26 301.1423 300.1350
27 301.1424 300.1351
28 301.1424 300.1351
29 301.1425 300.1352
Page: Previous 1 2 3 4 5 6 7 8 … 43 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/