MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Andy2
MS data file : PRT1311_JBEI_2.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 8 Sep 2025 at 17:18:13 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,460

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 101–200 (out of 4256)


Page: Previous 1 2 3 4 5 6 7  43 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3916 618.3326 1851.9760 1851.9479 15.2 1 4 1.5 +1Score > 19 indicates identity QAQLPGKLFTQNIGAHE + Deamidated (NQ)
4216 833.7418 2498.2036 2498.1875 6.43 1 4 1.6 +1Score > 19 indicates identity DKLFNLPFNMNTFHQMWGVK + 2 Oxidation (M)
3575 602.8173 1203.6200 1203.6135 5.41 1 4 0.81 +1Score > 21 indicates identity
Score > 16 indicates homology
ELFDPIISDR
3858 582.6255 1744.8547 1744.8883 -19.3 1 4 1 +1Score > 20 indicates identity
Score > 17 indicates homology
TPFQIAELNAQAQLAK + 3 Deamidated (NQ)
3749 721.8704 1441.7262 1441.7049 14.8 1 4 1 +1Score > 20 indicates identity
Score > 17 indicates homology
LQKDQNGADIPDK + Deamidated (NQ)
3782 384.7240 1534.8669 1534.8759 -5.87 1 4 0.49 +1Score > 14 indicates identity VLNVLGIFQEYIK
3731 712.8618 1423.7090 1423.7096 -0.38 1 4 0.56 +1Score > 20 indicates identity
Score > 14 indicates homology
DIEVHVFPDTPR
3635 419.5560 1255.6462 1255.6520 -4.66 1 4 0.56 +1Score > 20 indicates identity
Score > 14 indicates homology
RQQALQQALAE + Deamidated (NQ)
3952 652.3372 1953.9898 1953.9553 17.6 0 4 1.9 +1Score > 20 indicates identity VIGHLNTMHTISSMAWR + Deamidated (NQ)
3011 488.2851 487.2778 487.2867 -18.1 1 4 1 +1Score > 27 indicates identity
Score > 17 indicates homology
GGKAR
3832 567.9709 1700.8909 1700.8668 14.1 1 4 1.9 +1Score > 19 indicates identity RDFPHLTMSINGGIK + Oxidation (M)
4210 832.0815 2493.2227 2493.2646 -16.8 1 4 1.2 +1Score > 17 indicates identity TGSLNLYVMDLASGQIRQVTDGR
3552 583.8214 1165.6282 1165.6455 -14.8 0 4 1.6 +1Score > 19 indicates identity LQDIPPSQIR
3810 414.7298 1654.8901 1654.8638 15.9 1 4 1.5 +1Score > 18 indicates identity SPNDKLNSNLNLVAR + Deamidated (NQ)
3816 419.2317 1672.8977 1672.8784 11.5 1 4 1.7 +1Score > 19 indicates identity DYSHLTNDLVGAIKK
3676 434.5557 1300.6453 1300.6510 -4.42 1 4 0.72 +1Score > 21 indicates identity
Score > 15 indicates homology
INGQAQILEGQK + 3 Deamidated (NQ)
3597 307.8998 1227.5701 1227.5632 5.58 0 4 1.6 +1Score > 18 indicates identity NQTGIHTDWR + Deamidated (NQ)
4078 457.2539 2281.2331 2281.2008 14.2 1 4 0.92 +1Score > 16 indicates identity VAFTWQGGEPTLLGLAFYRR
3729 356.6689 1422.6465 1422.6489 -1.69 1 4 0.73 +1Score > 20 indicates identity
Score > 15 indicates homology
MYRYLAIANYE + Deamidated (NQ); Oxidation (M)
3970 687.0180 2058.0322 2058.0190 6.38 0 4 2.2 +1Score > 19 indicates identity ANAATGNLNILLPMVTSLDE + 2 Deamidated (NQ)
3560 396.5462 1186.6168 1186.6054 9.59 1 3 1 +1Score > 21 indicates identity
Score > 16 indicates homology
NLAQRSAQAAR + 2 Deamidated (NQ)
3659 425.8708 1274.5906 1274.5931 -2.01 1 3 0.95 +1Score > 20 indicates identity
Score > 16 indicates homology
AEQLFDFSYR
3162 316.6628 631.3110 631.3177 -10.5 0 3 1 +1Score > 22 indicates identity
Score > 16 indicates homology
NGSILE
3779 378.7003 1510.7721 1510.7569 10.1 1 3 2.2 +1Score > 19 indicates identity FEPIRPYEFTGR
3795 392.9577 1567.8017 1567.7704 19.9 0 3 0.64 +1Score > 21 indicates identity
Score > 14 indicates homology
NFNLAMINPIFTR + 2 Deamidated (NQ); Oxidation (M)
3551 583.8213 1165.6280 1165.6455 -15.0 0 3 1.9 +1Score > 19 indicates identity QLLNLRPSPE
3848 575.9874 1724.9404 1724.9097 17.8 1 3 1.4 +1Score > 17 indicates identity GFIASVVIDNKTFTGR + Deamidated (NQ)
3496 542.8126 1083.6106 1083.5924 16.8 0 3 1.8 +1Score > 18 indicates identity QIQLPSLQR + 2 Deamidated (NQ)
3671 647.8401 1293.6656 1293.6565 7.09 0 3 2.3 +1Score > 19 indicates identity AVADQTATAGYVK
4089 457.4542 2282.2346 2282.2787 -19.3 0 3 0.95 +1Score > 15 indicates identity GWAIPAATDIAFALGVLALLGSR
4004 720.3491 2158.0255 2158.0407 -7.05 1 3 2.2 +1Score > 19 indicates identity RLMQMMPQVLPSPDAMGPK + 2 Oxidation (M)
3324 435.7752 869.5358 869.5334 2.78 1 3 1.6 +1Score > 18 indicates identity VVAAIIER
3661 427.2466 1278.7180 1278.7044 10.6 0 3 1.2 +1Score > 16 indicates identity IAAVIGNHDTLR
3364 946.4894 945.4821 945.4920 -10.4 1 3 0.8 +1Score > 22 indicates identity
Score > 15 indicates homology
SEWANLVK
4290 935.1663 2802.4771 2802.4585 6.62 1 3 1.1 +1Score > 16 indicates identity ASQFAAIASALLINVGTLTQPRAQAMR + 4 Deamidated (NQ)
3415 496.2475 990.4804 990.4804 0.040 1 3 0.85 +1Score > 21 indicates identity
Score > 15 indicates homology
LGAEVMSQR + Deamidated (NQ)
3831 566.9599 1697.8579 1697.8485 5.51 0 3 0.78 +1Score > 20 indicates identity
Score > 14 indicates homology
SNHNFLVQAGNVQLR + 2 Deamidated (NQ)
4117 578.5653 2310.2321 2310.2406 -3.68 1 3 1.7 +1Score > 18 indicates identity KPGLTLGIGCETAQFPLPQVGK
3727 707.3559 1412.6972 1412.7082 -7.74 0 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology
GGDPALCQAALAAAK
3873 441.7287 1762.8857 1762.8625 13.2 1 3 0.76 +1Score > 20 indicates identity
Score > 14 indicates homology
AYNAIVDNNVELVSIE + Deamidated (NQ)
4204 826.4181 2476.2325 2476.2274 2.04 1 3 2.3 +1Score > 19 indicates identity NKSGQDSVPLLGDIPWFGQLFR + 3 Deamidated (NQ)
4047 738.0428 2211.1066 2211.1465 -18.1 1 3 2.2 +1Score > 19 indicates identity VTAMLFSMAVGLNAVSMAAKAK + Deamidated (NQ)
4186 818.7469 2453.2189 2453.1710 19.5 1 3 2.1 +1Score > 19 indicates identity LAQIDQHIADGELNLWQASSDK + 2 Deamidated (NQ)
3972 687.3522 2059.0348 2059.0585 -11.5 1 3 0.85 +1Score > 20 indicates identity
Score > 14 indicates homology
ADKLGYNLVVLDSQNNPAK + Deamidated (NQ)
3992 536.5284 2142.0845 2142.0602 11.4 1 3 2.1 +1Score > 18 indicates identity YALVTMCIGGGQGIAAIFER + Oxidation (M)
3919 466.4888 1861.9261 1861.9621 -19.3 1 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology
TGKPIYNAIVWQCRR + Deamidated (NQ)
3555 589.8148 1177.6150 1177.6091 5.05 1 3 1 +1Score > 21 indicates identity
Score > 15 indicates homology
DNAIAYKVQR + Deamidated (NQ)
3355 466.7646 931.5146 931.5226 -8.52 1 3 0.96 +1Score > 20 indicates identity
Score > 15 indicates homology
ITLEQLSK + Deamidated (NQ)
4045 737.7197 2210.1373 2210.1735 -16.4 0 3 1.8 +1Score > 17 indicates identity YPFTAITGVNTLFNALLNNK
4375 1094.2616 3279.7630 3279.7213 12.7 1 3 0.76 +1Score > 14 indicates identity WGVGLTFLLAATSVMAKDIQLLNVSYDPTR + Deamidated (NQ)
4088 571.5659 2282.2345 2282.2787 -19.4 0 2 1.1 +1Score > 15 indicates identity GWAIPAATDIAFALGVLALLGSR
4077 571.3152 2281.2317 2281.2008 13.6 1 2 1.2 +1Score > 16 indicates identity VAFTWQGGEPTLLGLAFYRR
3868 584.9854 1751.9344 1751.9352 -0.48 1 2 1.8 +1Score > 17 indicates identity LATHAGQIMDRDALLK
3374 478.2852 954.5558 954.5651 -9.65 1 2 1 +1Score > 15 indicates identity VPALHKYK
3648 633.3267 1264.6388 1264.6452 -4.99 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology
IALPGYAFQRE + Deamidated (NQ)
3144 309.6725 617.3304 617.3319 -2.34 0 2 0.71 +1Score > 21 indicates identity
Score > 13 indicates homology
MKPAR + Oxidation (M)
3592 613.3525 1224.6904 1224.6826 6.37 0 2 1.1 +1Score > 15 indicates identity GTGIPVIADGGIR
3611 412.2339 1233.6799 1233.6578 17.9 1 2 1.6 +1Score > 17 indicates identity NPRHQQALLR + 2 Deamidated (NQ)
4338 982.5291 2944.5655 2944.5328 11.1 1 2 1.1 +1Score > 15 indicates identity VAVARALLNPCSLLLLDEPAASLDAHSE
4257 665.5793 2658.2881 2658.2822 2.22 0 2 1.9 +1Score > 18 indicates identity MSGSNNFAGLSPVMNLLDVPFLFR + Deamidated (NQ); 2 Oxidation (M)
4092 571.5662 2282.2357 2282.2787 -18.8 0 2 1.1 +1Score > 15 indicates identity GWAIPAATDIAFALGVLALLGSR
3869 877.4731 1752.9316 1752.9159 8.99 0 2 1.9 +1Score > 17 indicates identity QAVISPSWSIHSGVGTK
4121 585.8213 2339.2561 2339.2235 13.9 0 2 1.2 +1Score > 16 indicates identity WPLMQGDYLSSLILAIYALR + Deamidated (NQ); Oxidation (M)
4070 756.0516 2265.1330 2265.1239 4.00 0 2 2.8 +1Score > 19 indicates identity NFGNVVLVMFVTGPVQQTALE + 3 Deamidated (NQ)
4215 833.7415 2498.2027 2498.1875 6.07 1 2 2.6 +1Score > 19 indicates identity DKLFNLPFNMNTFHQMWGVK + 2 Oxidation (M)
3431 504.2465 1006.4784 1006.4607 17.6 0 2 0.94 +1Score > 21 indicates identity
Score > 14 indicates homology
LQNIFNQE + 2 Deamidated (NQ)
4001 540.3055 2157.1929 2157.2350 -19.5 0 2 0.81 +1Score > 14 indicates identity YIGAVAILWVLAIGFNPALR + Deamidated (NQ)
4130 781.4220 2341.2442 2341.2001 18.8 1 2 1.6 +1Score > 17 indicates identity VLALYIATPRQWATHNMSPR + Deamidated (NQ); Oxidation (M)
3674 432.2486 1293.7240 1293.7115 9.66 1 2 1.3 +1Score > 16 indicates identity ILGAKASCISFK
3132 304.1646 606.3146 606.3159 -2.09 0 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology
MTALR + Oxidation (M)
3522 372.8858 1115.6356 1115.6372 -1.49 1 2 1.8 +1Score > 17 indicates identity MRLLQTLIE
3174 321.1918 640.3690 640.3656 5.34 0 2 1.3 +1Score > 16 indicates identity APNIAR
3422 499.7257 997.4368 997.4175 19.4 0 2 2.5 +1Score > 18 indicates identity MTPSNYQR + 2 Deamidated (NQ)
3771 498.5863 1492.7371 1492.7310 4.05 1 2 0.72 +1Score > 20 indicates identity
Score > 13 indicates homology
IESYQGAAGGWGAVK
3369 474.2820 946.5494 946.5633 -14.7 1 2 1 +1Score > 15 indicates identity MKIAILSR + Oxidation (M)
4086 761.7519 2282.2339 2282.2508 -7.43 1 2 1.2 +1Score > 15 indicates identity ILIVEDDTLLLQGLILAAQTE + 2 Deamidated (NQ)
4255 665.5782 2658.2837 2658.2822 0.56 0 2 2.1 +1Score > 18 indicates identity MSGSNNFAGLSPVMNLLDVPFLFR + Deamidated (NQ); 2 Oxidation (M)
3433 505.2318 1008.4490 1008.4442 4.78 0 2 3.1 +1Score > 19 indicates identity CVMLMLNE
3515 550.8042 1099.5938 1099.5848 8.21 0 2 0.98 +1Score > 20 indicates identity
Score > 14 indicates homology
IAWMPQGLGK
3517 369.8773 1106.6101 1106.6237 -12.3 1 2 2.5 +1Score > 18 indicates identity QKYFPIVGR
3856 577.9825 1730.9257 1730.8992 15.3 1 2 2.8 +1Score > 19 indicates identity ATSGAKAFVFQSVYAGK
3631 627.8416 1253.6686 1253.6615 5.67 1 2 2.8 +1Score > 19 indicates identity ADGNGIVLLPER + Deamidated (NQ)
3424 500.2302 998.4458 998.4345 11.4 1 2 2.5 +1Score > 18 indicates identity QFNANFEK + 2 Deamidated (NQ)
3523 373.5630 1117.6672 1117.6495 15.8 0 2 0.69 +1Score > 13 indicates identity LIYGLGVINR + Deamidated (NQ)
3653 635.8256 1269.6366 1269.6461 -7.44 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology
MLSGYIAGAIMK + Oxidation (M)
4398 1160.6090 3478.8052 3478.7654 11.4 1 2 1.3 +1Score > 15 indicates identity ASIFCKATGLSTTISNGVTSSIDAIIYASDFLR
3724 470.5610 1408.6612 1408.6888 -19.6 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology
QWQQLFFQER
3834 568.9721 1703.8945 1703.8763 10.6 0 2 2.6 +1Score > 18 indicates identity SAIDLGIAMQLTNISR + 2 Deamidated (NQ)
3713 462.5749 1384.7029 1384.7099 -5.06 0 2 0.93 +1Score > 20 indicates identity
Score > 14 indicates homology
VNLLGQNVNAWR + 2 Deamidated (NQ)
3774 499.2677 1494.7813 1494.8082 -18.0 0 2 3.4 +1Score > 19 indicates identity VQPINTALIPNWK + 2 Deamidated (NQ)
3790 774.9239 1547.8332 1547.8130 13.1 1 2 2.9 +1Score > 19 indicates identity MNAPDIKALFSSVR
3912 923.9672 1845.9198 1845.9472 -14.8 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology
SESVQSNSAVLVHFTLK + Deamidated (NQ)
4115 578.3135 2309.2249 2309.1903 15.0 1 2 2.3 +1Score > 18 indicates identity VGDVIDVGPLHITIIEANDYR + Deamidated (NQ)
4205 827.0917 2478.2533 2478.2179 14.3 0 1 2.7 +1Score > 18 indicates identity QPVQFANTITHLHHAGVTTYLE + 2 Deamidated (NQ)
3994 540.0541 2156.1873 2156.1987 -5.28 1 1 0.93 +1Score > 14 indicates identity DILQMQQLLSALIQRLTR + Deamidated (NQ); Oxidation (M)
3524 373.5631 1117.6675 1117.6495 16.1 0 1 0.76 +1Score > 13 indicates identity LIYGLGVINR + Deamidated (NQ)
3641 630.8537 1259.6928 1259.6808 9.54 1 1 2.8 +1Score > 18 indicates identity HYLKMLTQAR
3525 559.8412 1117.6678 1117.6608 6.34 0 1 0.76 +1Score > 13 indicates identity HANLPVLVVR + Deamidated (NQ)
4090 457.4543 2282.2351 2282.2787 -19.1 0 1 1.4 +1Score > 15 indicates identity GWAIPAATDIAFALGVLALLGSR
3468 525.7634 1049.5122 1049.5254 -12.5 0 1 0.98 +1Score > 21 indicates identity
Score > 14 indicates homology
QVLQHGDPR + Deamidated (NQ)
Page: Previous 1 2 3 4 5 6 7  43 Next 

Not what you expected? Try the select summary.