MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Andy2
MS data file : PRT1311_JBEI_2.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 8 Sep 2025 at 17:18:13 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,460

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1–100 (out of 4256)

Page: 1 2 3 4 5 6 … 43 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3114 587.3555 586.3482 586.3438 7.47 1 20 0.14 +1Score > 24 indicates identity AIVER
3392 974.4846 973.4773 973.4617 16.0 0 20 0.096 +1Score > 22 indicates identity DIQHFTGR + Deamidated (NQ)
3056 516.3159 515.3086 515.3180 -18.2 1 19 0.28 +1Score > 26 indicates identity GKGVR
3366 473.7488 945.4830 945.4655 18.6 1 17 0.2 +1Score > 22 indicates identity NTLEIVQE + Deamidated (NQ)
3624 622.8187 1243.6228 1243.6408 -14.5 0 16 0.12 +1Score > 20 indicates identity
Score > 20 indicates homology		 VQQDGSQVLLR + 2 Deamidated (NQ)
3590 405.8782 1214.6128 1214.5972 12.9 1 16 0.16 +1Score > 21 indicates identity EQWVEPLWK + Deamidated (NQ)
3726 470.5616 1408.6630 1408.6908 -19.7 1 15 0.15 +1Score > 20 indicates identity
Score > 20 indicates homology		 ASIYNAMPLEGVK + Deamidated (NQ); Oxidation (M)
3175 641.3766 640.3693 640.3656 5.77 0 15 0.06 +1Score > 16 indicates identity APNIAR
3086 545.3055 544.2982 544.2969 2.45 1 15 0.55 +1Score > 25 indicates identity ELAGR
3395 487.7463 973.4780 973.4903 -12.5 0 15 0.29 +1Score > 22 indicates identity LPMVDDLR + Oxidation (M)
3423 333.8222 998.4448 998.4491 -4.35 0 15 0.12 +1Score > 18 indicates identity MATPHINAE + Oxidation (M)
3163 634.2971 633.2898 633.2970 -11.3 0 15 0.21 +1Score > 21 indicates identity LTSQGE
3178 641.3778 640.3705 640.3656 7.64 0 15 0.069 +1Score > 16 indicates identity APNIAR
3396 487.7463 973.4780 973.4903 -12.5 0 15 0.32 +1Score > 22 indicates identity LPMVDDLR + Oxidation (M)
3367 473.7489 945.4832 945.4655 18.8 1 14 0.089 +1Score > 22 indicates identity
Score > 16 indicates homology		 NTLEIVQE + Deamidated (NQ)
3362 473.7470 945.4794 945.4655 14.8 1 14 0.23 +1Score > 22 indicates identity
Score > 20 indicates homology		 NTLEIVQE + Deamidated (NQ)
3717 347.9307 1387.6937 1387.6983 -3.34 0 14 0.26 +1Score > 21 indicates identity QQNVPVFLLGDR + 3 Deamidated (NQ)
3340 445.7303 889.4460 889.4327 15.0 0 14 0.095 +1Score > 22 indicates identity
Score > 16 indicates homology		 NMAINPSK + Oxidation (M)
3550 583.8204 1165.6262 1165.6455 -16.5 0 14 0.16 +1Score > 19 indicates identity QLLNLRPSPE
3365 473.7485 945.4824 945.4655 18.0 1 14 0.18 +1Score > 22 indicates identity
Score > 19 indicates homology		 NTLEIVQE + Deamidated (NQ)
3593 614.3541 1226.6936 1226.7122 -15.1 0 14 0.14 +1Score > 18 indicates identity AITQLILNLVE + Deamidated (NQ)
3806 546.9618 1637.8636 1637.8525 6.74 1 14 0.17 +1Score > 18 indicates identity SLNNQFASFIDKVR
3179 642.3855 641.3782 641.3748 5.31 1 14 0.12 -1Score > 17 indicates identity EVLPGK
3705 687.8707 1373.7268 1373.7191 5.67 1 13 0.24 +1Score > 20 indicates identity GDQYPIALEGALK
3393 487.7460 973.4774 973.4902 -13.2 1 13 0.42 +1Score > 22 indicates identity MPEDLLTR
3254 757.4595 756.4522 756.4494 3.77 1 13 0.32 +1Score > 21 indicates identity AVALVER
3394 487.7462 973.4778 973.4902 -12.7 1 13 0.44 +1Score > 22 indicates identity MPEDLLTR
3131 607.2661 606.2588 606.2609 -3.42 0 13 0.26 +1Score > 20 indicates identity TTNNR + 2 Deamidated (NQ)
3481 533.2678 1064.5210 1064.5138 6.80 1 13 0.32 +1Score > 21 indicates identity AQYEDIAQK
3677 651.8646 1301.7146 1301.7078 5.24 1 13 0.21 +1Score > 19 indicates identity SLDLDSIIAEVK
3487 541.2890 1080.5634 1080.5451 16.9 0 13 0.26 +1Score > 19 indicates identity TVDYSVLQR + Deamidated (NQ)
3147 618.3401 617.3328 617.3319 1.51 0 12 0.44 +1Score > 21 indicates identity AAAMVR
3120 591.3126 590.3053 590.3024 5.01 1 12 0.35 +1Score > 20 indicates identity SSELR
3486 541.2886 1080.5626 1080.5451 16.2 0 12 0.29 +1Score > 19 indicates identity TVDYSVLQR + Deamidated (NQ)
3313 845.4401 844.4328 844.4364 -4.24 1 12 0.67 +1Score > 23 indicates identity NIKLMPE + Deamidated (NQ)
3781 384.7032 1534.7837 1534.7562 17.9 1 12 0.089 +1Score > 21 indicates identity
Score > 14 indicates homology		 MAKDAGYTAVISHR + Oxidation (M)
3065 527.3333 526.3260 526.3227 6.30 0 12 0.066 +1Score > 13 indicates identity ALPAR
3220 688.4028 687.3955 687.4028 -10.5 1 12 0.53 +1Score > 21 indicates identity GSVKAAR
3427 502.2602 1002.5058 1002.4982 7.67 1 12 0.67 +1Score > 23 indicates identity
Score > 22 indicates homology		 TNGENINLK + Deamidated (NQ)
3421 333.4858 997.4356 997.4321 3.50 0 11 0.29 +1Score > 18 indicates identity VMSMNASAR + 2 Oxidation (M)
3772 374.1979 1492.7625 1492.7920 -19.7 1 11 0.3 +1Score > 20 indicates identity
Score > 18 indicates homology		 MVKGTVVGTTDTLR + Oxidation (M)
3562 396.5463 1186.6171 1186.6054 9.84 1 11 0.14 +1Score > 21 indicates identity
Score > 15 indicates homology		 NLAQRSAQAAR + 2 Deamidated (NQ)
3066 527.3336 526.3263 526.3227 6.87 0 11 0.082 +1Score > 13 indicates identity ALPAR
3715 462.5751 1384.7035 1384.6946 6.39 1 11 0.1 +1Score > 21 indicates identity
Score > 14 indicates homology		 QPLTQQQKDAAR + 2 Deamidated (NQ)
3115 589.3698 588.3625 588.3595 5.14 0 10 0.25 +1Score > 17 indicates identity LTSLR
3248 743.4450 742.4377 742.4337 5.38 0 10 0.61 +1Score > 21 indicates identity LTVASPR
3535 566.2767 1130.5388 1130.5543 -13.6 1 10 0.63 +1Score > 21 indicates identity
Score > 20 indicates homology		 FMHVPELSR + Oxidation (M)
3457 519.7914 1037.5682 1037.5618 6.25 0 10 0.25 +1Score > 16 indicates identity LLNHALGGSR + Deamidated (NQ)
3440 508.7629 1015.5112 1015.5087 2.53 0 10 0.45 +1Score > 22 indicates identity
Score > 19 indicates homology		 QLQVWGQR + 2 Deamidated (NQ)
3501 544.7845 1087.5544 1087.5695 -13.9 1 10 0.34 +1Score > 22 indicates identity
Score > 18 indicates homology		 AKIMDPQIR + Deamidated (NQ); Oxidation (M)
3084 544.3240 543.3167 543.3129 7.07 0 10 0.66 +1Score > 20 indicates identity LQAGR
3620 619.8594 1237.7042 1237.7255 -17.2 1 9 0.17 +1Score > 14 indicates identity QVRAAIQSLPR
4050 738.0445 2211.1117 2211.1465 -15.8 1 9 0.5 +1Score > 19 indicates identity VTAMLFSMAVGLNAVSMAAKAK + Deamidated (NQ)
3899 606.9945 1817.9617 1817.9822 -11.3 1 9 0.48 +1Score > 18 indicates identity LLLAGCTTTVTHRFTK
3325 435.7759 869.5372 869.5334 4.39 1 9 0.34 +1Score > 17 indicates identity VVAAIIER
3578 303.3969 1209.5585 1209.5448 11.3 1 9 0.41 +1Score > 20 indicates identity
Score > 18 indicates homology		 FSNDCEVIAR
3303 842.5022 841.4949 841.4909 4.76 1 9 0.39 +1Score > 17 indicates identity VEVTPGLK
3426 502.2599 1002.5052 1002.4982 7.08 1 8 0.34 +1Score > 23 indicates identity
Score > 16 indicates homology		 TNGENINLK + Deamidated (NQ)
3363 473.7475 945.4804 945.4920 -12.2 1 8 0.91 +1Score > 22 indicates identity
Score > 20 indicates homology		 SEWANLVK
4226 837.7548 2510.2426 2510.2587 -6.44 1 8 0.56 +1Score > 18 indicates identity MFQDNPLLAQLKQQLHSQTPR + 2 Deamidated (NQ); Oxidation (M)
3281 812.4045 811.3972 811.4089 -14.4 0 8 0.47 +1Score > 17 indicates identity HSHYLR
3623 415.5482 1243.6228 1243.6408 -14.5 0 8 0.39 +1Score > 20 indicates identity
Score > 16 indicates homology		 VQQDGSQVLLR + 2 Deamidated (NQ)
3814 837.4550 1672.8954 1672.8937 1.06 1 8 0.67 +1Score > 19 indicates identity IDGKVWQLPAAVYGR + Deamidated (NQ)
3373 478.2850 954.5554 954.5651 -10.1 1 8 0.29 +1Score > 15 indicates identity VPALHKYK
3556 393.5459 1177.6159 1177.6244 -7.23 1 8 1 +1Score > 21 indicates identity
Score > 20 indicates homology		 FFVRPLRDE
3247 743.4447 742.4374 742.4337 4.97 0 8 0.23 +1Score > 21 indicates identity
Score > 14 indicates homology		 LTVASPR
3536 377.8699 1130.5879 1130.5972 -8.21 1 8 1 +1Score > 21 indicates identity
Score > 20 indicates homology		 LFAAAGQKVPE + Deamidated (NQ)
3192 325.6681 649.3216 649.3217 -0.13 0 8 0.73 +1Score > 21 indicates identity
Score > 19 indicates homology		 IGAMSR + Oxidation (M)
4062 749.0699 2244.1879 2244.2266 -17.3 1 7 0.7 +1Score > 18 indicates identity TLLTYLQSGNLHSLRTWIK + Deamidated (NQ)
3334 442.2437 882.4728 882.4559 19.2 1 7 0.37 +1Score > 16 indicates identity RQHSLLE + Deamidated (NQ)
3518 370.8844 1109.6314 1109.6193 10.9 1 7 0.28 +1Score > 14 indicates identity QHLSADIKAK
3554 393.5455 1177.6147 1177.6165 -1.57 1 7 0.7 +1Score > 21 indicates identity
Score > 18 indicates homology		 LEYGTLVPMR
3719 465.2523 1392.7351 1392.7476 -8.97 0 7 0.82 +1Score > 19 indicates identity IGGMLTFGIPPFK + Oxidation (M)
3207 664.3452 663.3379 663.3340 5.92 0 7 1 +1Score > 22 indicates identity
Score > 19 indicates homology		 FNLNR + Deamidated (NQ)
4330 974.4785 2920.4137 2920.4627 -16.8 1 7 0.69 +1Score > 18 indicates identity LEALLNFQQVTLDLTGLDMASASLLDE + Deamidated (NQ)
3532 377.5484 1129.6234 1129.6165 6.07 1 6 1 +1Score > 20 indicates identity
Score > 19 indicates homology		 AVLIGQLECK
3177 641.3768 640.3695 640.3656 6.08 0 6 0.46 +1Score > 16 indicates identity APNIAR
3309 422.2712 842.5278 842.5225 6.30 0 6 0.64 +1Score > 17 indicates identity ILNVGISK
3148 618.3403 617.3330 617.3319 1.83 0 6 0.62 +1Score > 21 indicates identity
Score > 16 indicates homology		 AAAMVR
3627 415.5489 1243.6249 1243.6295 -3.76 1 6 0.49 +1Score > 20 indicates identity
Score > 15 indicates homology		 ISLENAQNLLE + Deamidated (NQ)
3563 396.5464 1186.6174 1186.6054 10.1 1 6 1 +1Score > 21 indicates identity
Score > 18 indicates homology		 NLAQRSAQAAR + 2 Deamidated (NQ)
3636 419.5564 1255.6474 1255.6520 -3.70 1 6 0.4 +1Score > 20 indicates identity
Score > 14 indicates homology		 RQQALQQALAE + Deamidated (NQ)
3574 401.2254 1200.6544 1200.6575 -2.61 1 6 1.3 +1Score > 19 indicates identity ATGGKGGGGAVLTR
3626 415.5488 1243.6246 1243.6408 -13.1 0 6 0.33 +1Score > 20 indicates identity
Score > 13 indicates homology		 VQQDGSQVLLR + 2 Deamidated (NQ)
3172 321.1914 640.3682 640.3796 -17.7 0 6 0.56 +1Score > 16 indicates identity LPGILE
3469 526.2802 1050.5458 1050.5453 0.50 1 5 1 +1Score > 20 indicates identity
Score > 18 indicates homology		 LMTSEMLVK
4233 849.4059 2545.1959 2545.1611 13.7 1 5 1.2 +1Score > 19 indicates identity MDSYVDQLQAQGGSMIMLAKGNR + Deamidated (NQ); 2 Oxidation (M)
3282 407.2070 812.3994 812.4140 -18.0 0 5 0.66 +1Score > 16 indicates identity QTIHSAR + Deamidated (NQ)
3202 657.4074 656.4001 656.3969 4.85 0 5 0.86 +1Score > 17 indicates identity QILAGR
4245 866.4698 2596.3876 2596.3782 3.60 1 5 0.56 +1Score > 15 indicates identity HMVIVDDVVTTGSTVAEIAQLLLR + Deamidated (NQ); Oxidation (M)
4152 802.1150 2403.3232 2403.2937 12.3 1 5 0.29 +1Score > 13 indicates identity YIAQQLNVVVNPKALFDVQIK + 4 Deamidated (NQ)
3055 515.3320 514.3247 514.3227 3.89 0 5 0.77 +1Score > 24 indicates identity
Score > 17 indicates homology		 LAGVR
4410 736.4014 3676.9706 3676.9877 -4.65 1 5 0.3 +1Score > 13 indicates identity NFSASITTMQAVIWIVTFLAMLALTIFIRYSR
4176 489.0516 2440.2216 2440.2346 -5.34 1 5 1.4 +1Score > 19 indicates identity IDPKSIGVGQYQHDVSQTQLAR + Deamidated (NQ)
3908 611.3094 1830.9064 1830.9323 -14.2 1 5 1 +1Score > 20 indicates identity
Score > 17 indicates homology		 NDSLLLQRILSNGSQTA + 2 Deamidated (NQ)
3632 419.5290 1255.5652 1255.5867 -17.1 0 5 1.3 +1Score > 18 indicates identity TMNLNLSGAYR + Deamidated (NQ); Oxidation (M)
3235 720.3491 719.3418 719.3450 -4.37 1 5 1 +1Score > 21 indicates identity
Score > 17 indicates homology		 DSETIR
3802 534.6296 1600.8670 1600.8937 -16.7 1 5 1.4 +1Score > 19 indicates identity NDRLAIVPDHPLLK + Deamidated (NQ)
3825 563.3010 1686.8812 1686.9087 -16.3 1 5 0.57 +1Score > 20 indicates identity
Score > 15 indicates homology		 AARTMALDVAGVDILR + Oxidation (M)
3657 425.8703 1274.5891 1274.5826 5.08 0 5 1 +1Score > 20 indicates identity
Score > 17 indicates homology		 YAVLCGGGANHR + Deamidated (NQ)
Page: 1 2 3 4 5 6 … 43 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/