MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Andy1
MS data file : PRT1311_JBEI_1.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 8 Sep 2025 at 17:17:19 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,450

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 201–300 (out of 4217)

Page: Previous 1 2 3 4 5 6 7 8 … 43 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3839 654.6830 1961.0272 1961.0153 6.07 1 1 3.2 +1Score > 18 indicates identity DEALHLTGTQHMLNLLR
4105 811.4245 2431.2517 2431.2846 -13.5 1 1 2.5 +1Score > 17 indicates identity LGVENDIALLNYLSSVTLSPADK
3395 547.2775 1092.5404 1092.5419 -1.36 1 1 0.94 +1Score > 21 indicates identity
Score > 13 indicates homology		 NAARMAALMK + Deamidated (NQ); Oxidation (M)
3760 541.9791 1622.9155 1622.9144 0.65 1 1 1.3 +1Score > 14 indicates identity VLRNDVVANVWPLK + Deamidated (NQ)
4122 616.0641 2460.2273 2460.1930 14.0 0 1 2.4 +1Score > 17 indicates identity LAQQQIAMLNGCTWLPVSWAR + 2 Deamidated (NQ); Oxidation (M)
3186 428.7690 855.5234 855.5178 6.63 0 1 2.9 +1Score > 18 indicates identity IALSSLPR
3264 486.2669 970.5192 970.5083 11.2 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 QQLDPTLR + Deamidated (NQ)
4157 854.4041 2560.1905 2560.2043 -5.40 1 1 2.5 +1Score > 17 indicates identity QWVLPQTNMGYYSELLTTLQR + 4 Deamidated (NQ); Oxidation (M)
3561 662.8358 1323.6570 1323.6558 0.96 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 VYKVNGLLSSNE + 2 Deamidated (NQ)
3728 521.9539 1562.8399 1562.8160 15.3 0 1 3.2 +1Score > 18 indicates identity LINQLMTAMIAGVR + Deamidated (NQ); 2 Oxidation (M)
3447 396.5460 1186.6162 1186.6306 -12.1 1 1 0.98 +1Score > 21 indicates identity
Score > 13 indicates homology		 ITQQNRLNAK + 2 Deamidated (NQ)
3960 713.0674 2136.1804 2136.1902 -4.62 1 1 1.2 +1Score > 14 indicates identity ISINSPALADPTLITRLADR
4060 588.3029 2349.1825 2349.1886 -2.59 1 1 3.5 +1Score > 19 indicates identity QISMVILEANAHQLLLPTDDE
4196 868.4102 2602.2088 2602.2205 -4.49 0 1 3.3 +1Score > 18 indicates identity IDGMMILGMFGGCFAAALWANNVK + Oxidation (M)
3196 435.7763 869.5380 869.5334 5.31 1 1 2.4 +1Score > 17 indicates identity VVAAIIER
3930 705.0476 2112.1210 2112.1255 -2.16 1 1 3 +1Score > 18 indicates identity GENIQVWIEPVVFNDLLK
3713 777.4153 1552.8160 1552.7919 15.6 1 1 4 +1Score > 19 indicates identity MVYSAADALKIAQR + Deamidated (NQ); Oxidation (M)
3699 384.4609 1533.8145 1533.8052 6.07 1 1 4 +1Score > 19 indicates identity RLNFQIVYPNDR
3315 338.1899 1011.5479 1011.5349 12.8 1 1 2.3 +1Score > 17 indicates identity AQPVGGLNEK
3779 844.8869 1687.7592 1687.7875 -16.8 1 1 3.4 +1Score > 18 indicates identity SWQPQQMSPLALER + 2 Deamidated (NQ); Oxidation (M)
4142 846.0593 2535.1561 2535.1482 3.10 1 0 2.5 +1Score > 17 indicates identity SCAAHNDLPLQFSTMKTGATDGGR + Deamidated (NQ)
3759 541.9789 1622.9149 1622.8992 9.66 0 0 1.4 +1Score > 14 indicates identity TLVAGVNVPVQVGGGVR + 2 Deamidated (NQ)
3291 492.2681 982.5216 982.5236 -1.99 1 0 2.7 +1Score > 17 indicates identity KFSPVSYR
3729 391.7173 1562.8401 1562.8165 15.1 0 0 3.4 +1Score > 18 indicates identity QGGAIALGHPLGASGTR + Deamidated (NQ)
4213 922.4633 2764.3681 2764.3604 2.77 1 0 3.5 +1Score > 18 indicates identity LAADFCGLFLMTDKQAALPYASAYK
3708 772.8972 1543.7798 1543.8066 -17.4 1 0 0.96 +1Score > 20 indicates identity
Score > 13 indicates homology		 NQATTAGNLLQRTR + Deamidated (NQ)
4097 800.4335 2398.2787 2398.3260 -19.7 0 0 2.2 +1Score > 16 indicates identity HQVNVTALVPPAVSLWLQALIE + Deamidated (NQ)
3559 441.5730 1321.6972 1321.6779 14.6 0 0 4.6 +1Score > 20 indicates identity AVSPWPPAADGVR
3723 777.4171 1552.8196 1552.7919 17.9 1 0 4 +1Score > 19 indicates identity MVYSAADALKIAQR + Deamidated (NQ); Oxidation (M)
3358 531.3087 1060.6028 1060.5838 18.0 1 0 2.2 +1Score > 16 indicates identity KIQLGIMLE + Deamidated (NQ); Oxidation (M)
3992 728.0435 2181.1087 2181.1001 3.95 1 0 3.5 +1Score > 18 indicates identity AFTRQSMSTLGNAWVDLLR + Oxidation (M)
3283 491.7907 981.5668 981.5607 6.25 1 0 1.3 +1Score > 14 indicates identity RVVASPEPK
3615 720.8604 1439.7062 1439.7330 -18.6 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 LNGEQPIACLVPK + 2 Deamidated (NQ)
3698 384.4607 1533.8137 1533.8052 5.55 1 0 4.3 +1Score > 19 indicates identity RLNFQIVYPNDR
4007 737.7225 2210.1457 2210.1120 15.2 1 0 2.8 +1Score > 17 indicates identity QPQALDGGAGSVWLNELIWR + Deamidated (NQ)
3741 527.6166 1579.8280 1579.8471 -12.1 1 0 4 +1Score > 19 indicates identity HPAGEPLKTLQSFR
3558 441.5729 1321.6969 1321.6878 6.89 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 LVANAVAEVLGHE + Deamidated (NQ)
4372 1013.0206 4048.0533 4048.1211 -16.7 1 0 1.2 +1Score > 13 indicates identity GNPPLQGNYTLWVGPPPSTVTLFGLISRPGKQPFTPGR + 2 Deamidated (NQ)
4243 993.1719 2976.4939 2976.4505 14.6 1 0 3.9 +1Score > 19 indicates identity VNRNLDFQLNVYNLFDTDYVASINK + 2 Deamidated (NQ)
3948 708.0297 2121.0673 2121.0928 -12.1 1 0 4.3 +1Score > 19 indicates identity KTLAQMPINPLFISDFNR + Deamidated (NQ); Oxidation (M)
1 300.2096 299.2023
2 301.0867 300.0794
3 301.0867 300.0794
4 301.0872 300.0799
5 301.0872 300.0799
6 301.1049 300.0976
7 301.1050 300.0977
8 301.1050 300.0977
9 301.1052 300.0979
10 301.1053 300.0980
11 301.1055 300.0982
12 301.1055 300.0982
13 301.1055 300.0982
14 301.1414 300.1341
15 301.1419 300.1346
16 301.1420 300.1347
17 301.1421 300.1348
18 301.1424 300.1351
19 301.1424 300.1351
20 301.1425 300.1352
21 301.1425 300.1352
22 301.1425 300.1352
23 301.1425 300.1352
24 301.1425 300.1352
25 301.1425 300.1352
26 301.1425 300.1352
27 301.1426 300.1353
28 301.1426 300.1353
29 301.1426 300.1353
30 301.1426 300.1353
31 301.1426 300.1353
32 301.1426 300.1353
33 301.1427 300.1354
34 301.1427 300.1354
35 301.1427 300.1354
36 301.1427 300.1354
37 301.1427 300.1354
38 301.1427 300.1354
39 301.1427 300.1354
40 301.1428 300.1355
41 301.1430 300.1357
42 301.1430 300.1357
43 301.1430 300.1357
44 301.1430 300.1357
45 301.1432 300.1359
46 301.1436 300.1363
47 301.1439 300.1366
48 301.2216 300.2143
49 301.2220 300.2147
50 301.2221 300.2148
51 301.9111 300.9038
52 301.9114 300.9041
53 302.1610 301.1537
54 303.0671 302.0598
55 303.0843 302.0770
56 303.0845 302.0772
57 303.0846 302.0773
58 303.0846 302.0773
59 303.0848 302.0775
60 303.0848 302.0775
Page: Previous 1 2 3 4 5 6 7 8 … 43 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/