MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Andy1
MS data file : PRT1311_JBEI_1.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 8 Sep 2025 at 17:17:19 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,450

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 101–200 (out of 4217)

Page: Previous 1 2 3 4 5 6 7 … 43 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3389 1093.5453 1092.5380 1092.5451 -6.49 1 3 0.65 +1Score > 21 indicates identity
Score > 14 indicates homology		 TIQQGFEAAK + Deamidated (NQ)
4093 799.4066 2395.1980 2395.1577 16.8 1 3 2.3 +1Score > 19 indicates identity YSCQLNQVQSLIVSVESQLAE + Deamidated (NQ)
4359 918.4651 3669.8313 3669.8495 -4.96 1 3 1.1 +1Score > 16 indicates identity KLSGQTHQVMTAVALADSQHILDCLVVTDVTFR + Deamidated (NQ); Oxidation (M)
3393 1093.5466 1092.5393 1092.5451 -5.31 1 3 1 +1Score > 21 indicates identity
Score > 16 indicates homology		 TIQQGFEAAK + Deamidated (NQ)
3752 539.9371 1616.7895 1616.7981 -5.31 1 3 0.69 +1Score > 20 indicates identity
Score > 14 indicates homology		 HSANQMLFLTGELR + Deamidated (NQ)
3394 1093.5470 1092.5397 1092.5451 -4.94 1 3 0.55 +1Score > 21 indicates identity
Score > 13 indicates homology		 TIQQGFEAAK + Deamidated (NQ)
3218 459.7765 917.5384 917.5334 5.45 0 3 1 +1Score > 16 indicates identity YGTLPLVR
3920 703.3678 2107.0816 2107.0415 19.0 1 3 2.1 +1Score > 19 indicates identity MQKQHNVVAGVDMGATHIR + Oxidation (M)
4009 738.0448 2211.1126 2211.1465 -15.4 1 3 2 +1Score > 19 indicates identity VTAMLFSMAVGLNAVSMAAKAK + Deamidated (NQ)
3889 522.2869 2085.1185 2085.1391 -9.87 1 3 1.5 +1Score > 17 indicates identity KIALLSALGIAAISMNVQAAE + 2 Deamidated (NQ)
3586 712.8619 1423.7092 1423.7129 -2.58 0 3 0.91 +1Score > 20 indicates identity
Score > 15 indicates homology		 VQAGHLINAPMQK + 2 Deamidated (NQ); Oxidation (M)
3978 538.2778 2149.0821 2149.0435 18.0 1 3 2.3 +1Score > 19 indicates identity GYAMSGIEPEIMGLGPVDAVK + Oxidation (M)
3706 772.8971 1543.7796 1543.8066 -17.5 1 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology		 NQATTAGNLLQRTR + Deamidated (NQ)
4008 738.0444 2211.1114 2211.1465 -15.9 1 3 2.1 +1Score > 19 indicates identity VTAMLFSMAVGLNAVSMAAKAK + Deamidated (NQ)
3081 319.6920 637.3694 637.3799 -16.4 1 3 0.74 +1Score > 14 indicates identity KSIYK
3601 712.8635 1423.7124 1423.6865 18.2 1 3 0.72 +1Score > 20 indicates identity
Score > 14 indicates homology		 LSSTSVTVEDCVK
3392 547.2769 1092.5392 1092.5274 10.9 0 3 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 MDPNTQFLK
4193 868.0750 2601.2032 2601.1653 14.6 1 3 1.7 +1Score > 18 indicates identity GEQAVLSQHLGDLSDDGIQMQWR + 3 Deamidated (NQ); Oxidation (M)
4276 811.9281 3243.6833 3243.7220 -11.9 1 3 1.1 +1Score > 16 indicates identity HGTQNVQQLVNLLLMKGNIGKPGAGICPLR + 2 Deamidated (NQ); Oxidation (M)
3961 713.0682 2136.1828 2136.1790 1.74 1 3 0.74 +1Score > 14 indicates identity VISLLVPTISGVHDLTETSR
3262 485.7637 969.5128 969.5243 -11.9 0 3 2.4 +1Score > 19 indicates identity QQLDPTLR
3242 473.7484 945.4822 945.4655 17.7 0 3 0.98 +1Score > 22 indicates identity
Score > 15 indicates homology		 ASLTNLTPE + Deamidated (NQ)
3745 796.8544 1591.6942 1591.6638 19.1 1 3 1.6 +1Score > 18 indicates identity NNDDFINPDLQER + 3 Deamidated (NQ)
3744 796.8525 1591.6904 1591.7161 -16.1 1 3 1.5 +1Score > 17 indicates identity NIHAAQHCNELQR + 2 Deamidated (NQ)
4123 821.0907 2460.2503 2460.2656 -6.22 1 3 1.5 +1Score > 17 indicates identity RGNITFANLVVATTQNNQVMNR
3862 1025.0225 2048.0304 2048.0361 -2.74 0 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 HMLNALTALGVSYTLSADR + Oxidation (M)
3265 486.2675 970.5204 970.5083 12.5 0 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 QQLDPTLR + Deamidated (NQ)
4010 738.0450 2211.1132 2211.1133 -0.070 1 3 2.2 +1Score > 19 indicates identity LQPDSLVDLKFIMADTGFGK + Deamidated (NQ); Oxidation (M)
4063 785.0637 2352.1693 2352.1669 0.99 1 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 SNGSVALTELAQQAGLPNSTTHR + Deamidated (NQ)
3117 688.3714 687.3641 687.3551 13.1 1 3 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 VDVEAR
3587 712.8620 1423.7094 1423.7017 5.46 1 3 0.78 +1Score > 20 indicates identity
Score > 14 indicates homology		 QVFMAKNADSALK + 2 Deamidated (NQ)
3755 540.6003 1618.7791 1618.7991 -12.4 1 3 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 SFKLYLNSFNQTR + 2 Deamidated (NQ)
3590 712.8622 1423.7098 1423.7017 5.72 1 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 MQTPHILIVEDE
4128 618.3188 2469.2461 2469.2623 -6.54 0 3 2.1 +1Score > 18 indicates identity LGMLVFFGMLGWALLTAMNQPK + 2 Oxidation (M)
3446 396.5459 1186.6159 1186.6128 2.58 1 3 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 MAARQLQPVR + 2 Deamidated (NQ); Oxidation (M)
3648 740.8705 1479.7264 1479.6996 18.1 1 3 0.83 +1Score > 21 indicates identity
Score > 14 indicates homology		 MARSGMRPLSMVE + Oxidation (M)
3900 700.7126 2099.1160 2099.1038 5.80 1 2 1.2 +1Score > 16 indicates identity AQTVLSGYIDYISTLVVKE + Deamidated (NQ)
3828 967.5120 1933.0094 1933.0157 -3.22 1 2 2.1 +1Score > 18 indicates identity IVLDVASSVFNTGVQEGAK
4079 792.7491 2375.2255 2375.1791 19.5 1 2 2.1 +1Score > 18 indicates identity VMLTIDASTGQNAVSQAKLFHE + Oxidation (M)
3175 415.7423 829.4700 829.4545 18.7 1 2 1 +1Score > 23 indicates identity
Score > 15 indicates homology		 AGIKALQE + Deamidated (NQ)
3736 790.9203 1579.8260 1579.8206 3.48 1 2 2.5 +1Score > 19 indicates identity IYDDISNGKLSSLR
3490 411.8791 1232.6155 1232.6336 -14.7 0 2 0.92 +1Score > 22 indicates identity
Score > 14 indicates homology		 IGWVAGTGLMGR + Oxidation (M)
3710 772.8984 1543.7822 1543.7842 -1.26 1 2 0.93 +1Score > 20 indicates identity
Score > 15 indicates homology		 ITGGLDDTQLRNLE
3635 727.3738 1452.7330 1452.7065 18.3 1 2 0.82 +1Score > 21 indicates identity
Score > 14 indicates homology		 QMRQLMTSQLGK + Deamidated (NQ); 2 Oxidation (M)
3535 639.8361 1277.6576 1277.6359 17.0 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 LVGANIAMDMVK + Deamidated (NQ); Oxidation (M)
3296 496.2482 990.4818 990.4804 1.45 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 IAQEMLDR + Oxidation (M)
3758 812.4111 1622.8076 1622.7974 6.31 0 2 0.79 +1Score > 20 indicates identity
Score > 14 indicates homology		 MADQVFTLNVLDNK + Oxidation (M)
3638 729.8415 1457.6684 1457.6457 15.6 0 2 2.7 +1Score > 19 indicates identity TVNMAVLDQSDHE
3399 366.8549 1097.5429 1097.5506 -7.00 1 2 0.63 +1Score > 20 indicates identity
Score > 13 indicates homology		 GVYNDQFKK
3771 419.2318 1672.8981 1672.8784 11.8 1 2 2.5 +1Score > 19 indicates identity DYSHLTNDLVGAIKK
3391 1093.5460 1092.5387 1092.5451 -5.85 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 TIQQGFEAAK + Deamidated (NQ)
3366 537.2864 1072.5582 1072.5764 -16.9 0 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 SAQADLLNLK + Deamidated (NQ)
3259 321.2045 960.5917 960.5756 16.7 1 2 0.62 +1Score > 13 indicates identity IQKAVVFR + Deamidated (NQ)
3188 859.4177 858.4104 858.4083 2.48 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 QRQPVTE + 2 Deamidated (NQ)
3665 499.6029 1495.7869 1495.7718 10.1 0 2 2.9 +1Score > 19 indicates identity VNMQGIQVWHLR + Oxidation (M)
3909 1051.5404 2101.0662 2101.0390 13.0 1 2 2.8 +1Score > 19 indicates identity IVGGAYLLWFAWCSMRR + Oxidation (M)
3588 475.5771 1423.7095 1423.7168 -5.12 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 GAAPPGQKGQANATR + Deamidated (NQ)
3448 594.3279 1186.6412 1186.6557 -12.2 1 2 0.94 +1Score > 20 indicates identity
Score > 14 indicates homology		 ELGLVATDTLR
4226 942.1213 2823.3421 2823.3524 -3.67 1 2 2.2 +1Score > 18 indicates identity DAGALPIEVDVSNLNMGDVIDVYPYK + Deamidated (NQ); Oxidation (M)
4176 861.7221 2582.1445 2582.1650 -7.97 1 2 1.5 +1Score > 16 indicates identity YQGYCDAMMLHNLSPLRMNPR + Oxidation (M)
4058 586.5726 2342.2613 2342.2230 16.3 1 2 1.5 +1Score > 16 indicates identity RQGISLSGGDPLHPQNVPDILK + 2 Deamidated (NQ)
3726 391.7170 1562.8389 1562.8165 14.3 0 2 2.6 +1Score > 18 indicates identity QGGAIALGHPLGASGTR + Deamidated (NQ)
3735 790.9202 1579.8258 1579.8028 14.6 1 2 3 +1Score > 19 indicates identity QTCALLDYARLQK + Deamidated (NQ)
3773 558.6406 1672.9000 1672.8784 12.9 1 2 2.9 +1Score > 19 indicates identity DYSHLTNDLVGAIKK
3614 720.8600 1439.7054 1439.6795 18.0 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 LQFHLMLDEFF + Deamidated (NQ)
3852 665.6680 1993.9822 1993.9493 16.5 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 HIEINGDNLHDYLGVQR + 2 Deamidated (NQ)
4116 818.7367 2453.1883 2453.1414 19.1 0 1 2.9 +1Score > 19 indicates identity MTAQITMNAGADSSLVNNTGTINK + 2 Deamidated (NQ)
3774 558.6407 1672.9003 1672.8784 13.1 1 1 3 +1Score > 19 indicates identity DYSHLTNDLVGAIKK
3603 712.8638 1423.7130 1423.6865 18.7 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 LSSTSVTVEDCVK
3285 328.5139 982.5199 982.5236 -3.82 0 1 2.4 +1Score > 18 indicates identity SFLQFVSR
3772 419.2318 1672.8981 1672.9148 -10.00 0 1 3 +1Score > 19 indicates identity TLPANGITAIFGVSGAGK
3727 391.7172 1562.8397 1562.8165 14.8 0 1 2.7 +1Score > 18 indicates identity QGGAIALGHPLGASGTR + Deamidated (NQ)
3329 1027.5708 1026.5635 1026.5570 6.32 1 1 2.9 +1Score > 19 indicates identity QAKTSTVHR
3613 720.8596 1439.7046 1439.6933 7.91 0 1 0.89 +1Score > 20 indicates identity
Score > 13 indicates homology		 NPINGDPIFLDPE
3359 531.3093 1060.6040 1060.5838 19.1 1 1 1.8 +1Score > 16 indicates identity KIQLGIMLE + Deamidated (NQ); Oxidation (M)
3556 661.8557 1321.6968 1321.6878 6.88 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 LVANAVAEVLGHE + Deamidated (NQ)
4006 737.7222 2210.1448 2210.1167 12.7 1 1 2.2 +1Score > 17 indicates identity LHPLMQQRQLHAWNATHK + 2 Deamidated (NQ)
3690 755.3839 1508.7532 1508.7810 -18.4 1 1 0.99 +1Score > 20 indicates identity
Score > 14 indicates homology		 FRPVAGIFGSAMKE
4189 866.1364 2595.3874 2595.4159 -11.0 1 1 1.5 +1Score > 15 indicates identity IVEYAVKPLLAQSGPLDDIDVALR + Deamidated (NQ)
4393 1172.3759 4685.4745 4685.3905 17.9 1 1 0.75 +1Score > 13 indicates identity YVIGIWTGRPDGTPVVGQFGFASAVPLLNQVNNILLSRSANLPE + 6 Deamidated (NQ)
3551 439.5403 1315.5991 1315.6053 -4.76 0 1 2.9 +1Score > 18 indicates identity VIFCTFGDAMR
3664 498.5862 1492.7368 1492.7310 3.84 1 1 0.86 +1Score > 20 indicates identity
Score > 13 indicates homology		 IESYQGAAGGWGAVK
3952 531.5239 2122.0665 2122.0921 -12.1 1 1 3.4 +1Score > 19 indicates identity LVAEFHDLIHTFPMLNPK + Deamidated (NQ)
4000 1091.5651 2181.1156 2181.0935 10.1 1 1 2.7 +1Score > 18 indicates identity MAWPQARVHGLLVQSMANR + Deamidated (NQ); Oxidation (M)
3269 487.2488 972.4830 972.4777 5.46 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 DIQHFTGR
3554 441.5727 1321.6963 1321.6878 6.44 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 LVANAVAEVLGHE + Deamidated (NQ)
3831 967.5148 1933.0150 1933.0264 -5.87 1 1 3 +1Score > 18 indicates identity MATTLAALTLPQMVKLAE + 2 Oxidation (M)
4161 643.0461 2568.1553 2568.1869 -12.3 1 1 2.4 +1Score > 17 indicates identity MQTQMQTQQIQQKGMLNQQLK + 4 Deamidated (NQ); 2 Oxidation (M)
3313 338.1898 1011.5476 1011.5349 12.5 1 1 2 +1Score > 17 indicates identity STLIHQGEK
3705 772.8971 1543.7796 1543.7664 8.57 1 1 0.84 +1Score > 20 indicates identity
Score > 13 indicates homology		 MLQEAVDALLDNGR
4165 858.4050 2572.1932 2572.2366 -16.9 1 1 2.4 +1Score > 17 indicates identity LAQQEAIASGQVQMIVGTHAIFQE + 4 Deamidated (NQ)
4047 781.3896 2341.1470 2341.1042 18.3 1 1 3.9 +1Score > 19 indicates identity ALARDDVDAVILCTPTQMHAE + Oxidation (M)
3748 804.9186 1607.8226 1607.8454 -14.1 1 1 3.5 +1Score > 19 indicates identity LSSRQCAAFVSGVVK
3931 529.7985 2115.1649 2115.1576 3.46 1 1 1.6 +1Score > 16 indicates identity DVGVDNAGAKAGLTFLVDLIK
3598 475.5776 1423.7110 1423.7168 -4.07 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 SLRQQHQSVSPR + 2 Deamidated (NQ)
3539 648.8549 1295.6952 1295.7020 -5.18 1 1 3.7 +1Score > 19 indicates identity HVLSRMALQLE
3597 712.8627 1423.7108 1423.7129 -1.46 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 VQAGHLINAPMQK + 2 Deamidated (NQ); Oxidation (M)
3959 710.9786 2129.9140 2129.9277 -6.43 1 1 1.6 +1Score > 15 indicates identity YQNTNIEGIYAVGDNTGAVE + 3 Deamidated (NQ)
3905 700.9747 2099.9023 2099.8856 7.92 0 1 1.7 +1Score > 16 indicates identity MFDAYVNTFSSTFNVPME + Deamidated (NQ)
3560 441.5730 1321.6972 1321.6878 7.11 1 1 4.1 +1Score > 20 indicates identity GITVQELVSYGR + Deamidated (NQ)
Page: Previous 1 2 3 4 5 6 7 … 43 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/