MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | Andy1 |
| MS data file | : | PRT1311_JBEI_1.mgf |
| Database | : | Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues) |
| Timestamp | : | 8 Sep 2025 at 17:17:19 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | GluC_Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,450 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 3656 |
497.2787 | 1488.8143 | 1488.8188 | -3.02 | 1 | 18 | 0.063 | 1Score > 18 indicates identity |
QVQAFIGVIAGKQK + 3 Deamidated (NQ) |
| 3241 |
473.7482 | 945.4818 | 945.4920 | -10.7 | 1 | 16 | 0.21 | 1Score > 22 indicates identity Score > 22 indicates homology |
SEWANLVK |
| 3243 |
473.7484 | 945.4822 | 945.4655 | 17.7 | 1 | 16 | 0.11 | 1Score > 22 indicates identity Score > 19 indicates homology |
NTLEIVQE + Deamidated (NQ) |
| 3153 |
801.4562 | 800.4489 | 800.4643 | -19.3 | 0 | 15 | 0.13 | 1Score > 22 indicates identity Score > 19 indicates homology |
LLLSNLE |
| 3571 |
681.3682 | 1360.7218 | 1360.7351 | -9.71 | 1 | 14 | 0.079 | 1Score > 20 indicates identity Score > 15 indicates homology |
GELLFLIGGNGSGK |
| 3621 |
483.5637 | 1447.6693 | 1447.6476 | 15.0 | 1 | 14 | 0.22 | 1Score > 19 indicates identity |
FCQALMTELYR + Deamidated (NQ); Oxidation (M) |
| 3581 |
712.8618 | 1423.7090 | 1423.7096 | -0.38 | 1 | 13 | 0.28 | 1Score > 20 indicates identity Score > 20 indicates homology |
DIEVHVFPDTPR |
| 3620 |
483.5637 | 1447.6693 | 1447.6579 | 7.85 | 1 | 12 | 0.35 | 1Score > 19 indicates identity |
IDTQDIEASHYR + Deamidated (NQ) |
| 3192 |
435.7586 | 869.5026 | 869.4858 | 19.3 | 0 | 11 | 0.19 | 1Score > 17 indicates identity |
VAQVQPVK + 2 Deamidated (NQ) |
| 3185 |
428.7686 | 855.5226 | 855.5178 | 5.69 | 0 | 11 | 0.25 | 1Score > 18 indicates identity |
IALSSLPR |
| 3201 |
899.5031 | 898.4958 | 898.4872 | 9.58 | 1 | 11 | 0.31 | 1Score > 19 indicates identity |
ELGQSLPR |
| 3973 |
714.3898 | 2140.1476 | 2140.1739 | -12.3 | 1 | 11 | 0.18 | 1Score > 16 indicates identity |
LNNALSAIQTTVKPISEIAR + 2 Deamidated (NQ) |
| 3286 |
328.5141 | 982.5205 | 982.5124 | 8.24 | 1 | 11 | 0.26 | 1Score > 18 indicates identity |
QVKFFADK + Deamidated (NQ) |
| 3543 |
434.8775 | 1301.6107 | 1301.5856 | 19.2 | 1 | 11 | 0.16 | 1Score > 20 indicates identity Score > 15 indicates homology |
HQGLATEVMCR + Deamidated (NQ) |
| 3584 |
475.5770 | 1423.7092 | 1423.7168 | -5.33 | 1 | 11 | 0.49 | 1Score > 20 indicates identity |
GAAPPGQKGQANATR + Deamidated (NQ) |
| 3570 |
681.3681 | 1360.7216 | 1360.7351 | -9.86 | 1 | 11 | 0.12 | 1Score > 20 indicates identity Score > 14 indicates homology |
GELLFLIGGNGSGK |
| 4133 |
834.0765 | 2499.2077 | 2499.2540 | -18.5 | 1 | 10 | 0.5 | 1Score > 19 indicates identity |
QDSRMLLATQHSATGQVTQWIK + Deamidated (NQ) |
| 3287 |
328.5143 | 982.5211 | 982.5124 | 8.85 | 1 | 10 | 0.35 | 1Score > 18 indicates identity |
QVKFFADK + Deamidated (NQ) |
| 3206 |
455.2355 | 908.4564 | 908.4459 | 11.6 | 0 | 9 | 0.58 | 1Score > 19 indicates identity |
LMTLMQR + Deamidated (NQ); Oxidation (M) |
| 4164 |
858.4039 | 2572.1899 | 2572.2227 | -12.8 | 1 | 9 | 0.35 | 1Score > 17 indicates identity |
SPAAQRLLNTTAGMDPAWDAAIQR + 3 Deamidated (NQ); Oxidation (M) |
| 4124 |
824.0731 | 2469.1975 | 2469.2176 | -8.14 | 1 | 9 | 0.65 | 1Score > 20 indicates identity |
RALAYISSIIQAGDGGAPAFYQAE + Deamidated (NQ) |
| 3275 |
327.2079 | 978.6019 | 978.5974 | 4.54 | 1 | 9 | 0.16 | 1Score > 13 indicates identity |
KPAVPPSKR |
| 3205 |
455.2351 | 908.4556 | 908.4459 | 10.7 | 0 | 9 | 0.65 | 1Score > 19 indicates identity |
LMTLMQR + Deamidated (NQ); Oxidation (M) |
| 3217 |
458.7391 | 915.4636 | 915.4484 | 16.7 | 0 | 9 | 0.31 | 1Score > 22 indicates identity Score > 16 indicates homology |
MQQAVPDK |
| 3397 |
547.2776 | 1092.5406 | 1092.5419 | -1.17 | 1 | 9 | 0.2 | 1Score > 21 indicates identity Score > 14 indicates homology |
NAARMAALMK + Deamidated (NQ); Oxidation (M) |
| 3270 |
487.7459 | 973.4772 | 973.4869 | -9.89 | 1 | 9 | 0.2 | 1Score > 22 indicates identity Score > 14 indicates homology |
IDHYLGKE |
| 4290 |
820.9520 | 3279.7789 | 3279.7213 | 17.6 | 1 | 8 | 0.2 | 1Score > 14 indicates identity |
WGVGLTFLLAATSVMAKDIQLLNVSYDPTR + Deamidated (NQ) |
| 3743 |
527.9507 | 1580.8303 | 1580.8383 | -5.07 | 1 | 8 | 0.69 | 1Score > 19 indicates identity |
DIPVNQLSAGQQRR |
| 3191 |
435.7584 | 869.5022 | 869.4858 | 18.9 | 0 | 8 | 0.43 | 1Score > 17 indicates identity |
VAQVQPVK + 2 Deamidated (NQ) |
| 3369 |
358.5424 | 1072.6054 | 1072.6029 | 2.29 | 0 | 8 | 0.72 | 1Score > 19 indicates identity |
QLGYPGAVLR |
| 3071 |
623.3261 | 622.3188 | 622.3174 | 2.32 | 0 | 8 | 0.9 | 1Score > 20 indicates identity |
LSTTTT |
| 3099 |
667.3012 | 666.2939 | 666.2973 | -5.02 | 1 | 8 | 0.89 | 1Score > 20 indicates identity |
YEAQR + Deamidated (NQ) |
| 3500 |
415.5483 | 1243.6231 | 1243.6408 | -14.3 | 0 | 8 | 0.52 | 1Score > 20 indicates identity Score > 17 indicates homology |
VQQDGSQVLLR + 2 Deamidated (NQ) |
| 3294 |
492.2682 | 982.5218 | 982.5236 | -1.79 | 1 | 7 | 0.53 | 1Score > 17 indicates identity |
KFSPVSYR |
| 3864 |
1030.0277 | 2058.0408 | 2058.0190 | 10.6 | 0 | 7 | 0.24 | 1Score > 20 indicates identity Score > 14 indicates homology |
ANAATGNLNILLPMVTSLDE + 2 Deamidated (NQ) |
| 3101 |
667.3022 | 666.2949 | 666.2973 | -3.52 | 1 | 7 | 1 | 1Score > 20 indicates identity Score > 20 indicates homology |
YEAQR + Deamidated (NQ) |
| 3599 |
712.8629 | 1423.7112 | 1423.7017 | 6.72 | 1 | 7 | 1 | 1Score > 20 indicates identity Score > 20 indicates homology |
QVFMAKNADSALK + 2 Deamidated (NQ) |
| 3786 |
852.8840 | 1703.7534 | 1703.7234 | 17.6 | 1 | 7 | 0.74 | 1Score > 18 indicates identity |
ATANNGQQQQVQEQR + 5 Deamidated (NQ) |
| 3176 |
416.2503 | 830.4860 | 830.4974 | -13.7 | 1 | 7 | 0.73 | 1Score > 18 indicates identity |
ISVTQKR |
| 3290 |
492.2681 | 982.5216 | 982.5092 | 12.7 | 1 | 7 | 0.62 | 1Score > 17 indicates identity |
KCLFLMR + Oxidation (M) |
| 3580 |
712.8617 | 1423.7088 | 1423.6943 | 10.2 | 1 | 7 | 0.83 | 1Score > 20 indicates identity Score > 18 indicates homology |
VQYQVDGQTKTR + 2 Deamidated (NQ) |
| 3585 |
712.8619 | 1423.7092 | 1423.7096 | -0.24 | 1 | 7 | 0.29 | 1Score > 20 indicates identity Score > 14 indicates homology |
DIEVHVFPDTPR |
| 3763 |
546.9590 | 1637.8552 | 1637.8236 | 19.3 | 1 | 7 | 0.97 | 1Score > 19 indicates identity |
YSYVMHLVSRVVGE |
| 4078 |
792.7450 | 2375.2132 | 2375.1753 | 16.0 | 1 | 6 | 0.94 | 1Score > 19 indicates identity |
TPVFNTLPMMGKASPVSLGVPSE + Deamidated (NQ); Oxidation (M) |
| 3756 |
811.9075 | 1621.8004 | 1621.8134 | -7.97 | 1 | 6 | 1 | 1Score > 20 indicates identity Score > 19 indicates homology |
HNGEIVPLDDIMLR + Deamidated (NQ) |
| 3827 |
967.0117 | 1932.0088 | 1931.9961 | 6.59 | 1 | 6 | 0.74 | 1Score > 18 indicates identity |
VMRDMVYNLPVLTPPR + 2 Oxidation (M) |
| 3562 |
665.3706 | 1328.7266 | 1328.7187 | 5.97 | 1 | 6 | 1 | 1Score > 20 indicates identity Score > 19 indicates homology |
NLDLDSIIAEVK |
| 3951 |
708.3014 | 2121.8824 | 2121.8540 | 13.3 | 1 | 6 | 0.24 | 1Score > 13 indicates identity |
YMMDQNNIGSGSTVAELME + Deamidated (NQ); 2 Oxidation (M) |
| 4099 |
602.0965 | 2404.3569 | 2404.3186 | 15.9 | 1 | 6 | 0.23 | 1Score > 13 indicates identity |
QTSGVQQQIRQALSALPLPVNR + Deamidated (NQ) |
| 3135 |
376.2344 | 750.4542 | 750.4613 | -9.36 | 1 | 6 | 0.24 | 1Score > 13 indicates identity |
LGRLHR |
| 4151 |
849.0729 | 2544.1969 | 2544.2094 | -4.91 | 1 | 6 | 0.92 | 1Score > 18 indicates identity |
QWVLPQTNMGYYSELLTTLQR + 4 Deamidated (NQ) |
| 3100 |
334.1545 | 666.2944 | 666.2861 | 12.6 | 0 | 6 | 1 | 1Score > 20 indicates identity Score > 19 indicates homology |
FVSQGE + Deamidated (NQ) |
| 3152 |
801.4550 | 800.4477 | 800.4392 | 10.6 | 0 | 6 | 0.35 | 1Score > 21 indicates identity Score > 14 indicates homology |
LQDIGVR + Deamidated (NQ) |
| 3289 |
492.2680 | 982.5214 | 982.5236 | -2.20 | 1 | 6 | 0.88 | 1Score > 18 indicates identity |
KFSPVSYR |
| 3533 |
639.8355 | 1277.6564 | 1277.6359 | 16.1 | 0 | 6 | 1 | 1Score > 20 indicates identity Score > 18 indicates homology |
LVGANIAMDMVK + Deamidated (NQ); Oxidation (M) |
| 3078 |
319.6919 | 637.3692 | 637.3660 | 5.10 | 0 | 6 | 0.42 | 1Score > 14 indicates identity |
VVAHGR |
| 4252 |
1008.8519 | 3023.5339 | 3023.5195 | 4.76 | 0 | 6 | 0.65 | 1Score > 16 indicates identity |
ALANSPAADVPLPDLIITCNNICNTLLK + 3 Deamidated (NQ) |
| 3438 |
579.3338 | 1156.6530 | 1156.6465 | 5.64 | 1 | 6 | 1.2 | 1Score > 19 indicates identity |
VLQHFTRTR |
| 4029 |
767.7296 | 2300.1670 | 2300.1900 | -10.00 | 0 | 5 | 1.1 | 1Score > 18 indicates identity |
QIIGADGLIFQDLNDLIDAVR + 2 Deamidated (NQ) |
| 3647 |
366.6724 | 1462.6605 | 1462.6735 | -8.92 | 1 | 5 | 1.2 | 1Score > 19 indicates identity |
SNHAGTTPMGYRR + Oxidation (M) |
| 4102 |
805.7488 | 2414.2246 | 2414.2726 | -19.9 | 1 | 5 | 1.1 | 1Score > 18 indicates identity |
IGAGNVTKLANQVIVALNIAAMSE + 2 Deamidated (NQ); Oxidation (M) |
| 3660 |
497.5669 | 1489.6789 | 1489.6759 | 2.00 | 0 | 5 | 1 | 1Score > 20 indicates identity Score > 18 indicates homology |
DSSFINNITFGMK + Deamidated (NQ); Oxidation (M) |
| 3600 |
712.8633 | 1423.7120 | 1423.7096 | 1.72 | 1 | 5 | 1 | 1Score > 20 indicates identity Score > 18 indicates homology |
DIEVHVFPDTPR |
| 3972 |
1071.0730 | 2140.1314 | 2140.0913 | 18.8 | 1 | 5 | 0.82 | 1Score > 17 indicates identity |
NSGAELGKPVTIGNNVWIGGR + 2 Deamidated (NQ) |
| 3945 |
707.3662 | 2119.0768 | 2119.0480 | 13.6 | 1 | 5 | 1.4 | 1Score > 19 indicates identity |
GGSPLMVYSRQQQQALAQR + 2 Deamidated (NQ) |
| 3330 |
1027.5713 | 1026.5640 | 1026.5570 | 6.81 | 1 | 5 | 1.3 | 1Score > 19 indicates identity |
QAKTSTVHR |
| 4215 |
926.1664 | 2775.4774 | 2775.4550 | 8.05 | 1 | 5 | 0.78 | 1Score > 16 indicates identity |
RLMMVALLVIAPLSAATAADQTNPYK + 2 Deamidated (NQ); Oxidation (M) |
| 3618 |
724.8406 | 1447.6666 | 1447.6799 | -9.17 | 1 | 5 | 1.5 | 1Score > 19 indicates identity |
SQPPSMESAMVLR + Oxidation (M) |
| 3963 |
713.3592 | 2137.0558 | 2137.0692 | -6.26 | 0 | 5 | 1.5 | 1Score > 19 indicates identity |
GQVVSPVNFNSPGQVVIAGHK + 4 Deamidated (NQ) |
| 3292 |
492.2681 | 982.5216 | 982.5196 | 2.12 | 1 | 5 | 1 | 1Score > 17 indicates identity |
RQAQHTLK + 2 Deamidated (NQ) |
| 3347 |
523.7588 | 1045.5030 | 1045.5226 | -18.7 | 0 | 5 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
VTSCLVNPR + Deamidated (NQ) |
| 3499 |
415.5480 | 1243.6222 | 1243.6408 | -15.0 | 1 | 5 | 0.89 | 1Score > 20 indicates identity Score > 17 indicates homology |
LNSNLNLVARE + 2 Deamidated (NQ) |
| 4438 |
955.9199 | 6684.3884 | 6684.4507 | -9.33 | 1 | 5 | 0.34 | 1Score > 13 indicates identity |
QLISHFAVIFFPLLPALISGGLILGFRNVIGDLPMSNGQTLAQMYPSLQTIYDFLWLIGE + 5 Deamidated (NQ); 2 Oxidation (M) |
| 3398 |
366.8545 | 1097.5417 | 1097.5506 | -8.09 | 1 | 5 | 0.98 | 1Score > 20 indicates identity Score > 17 indicates homology |
GVYNDQFKK |
| 3575 |
693.3588 | 1384.7030 | 1384.6888 | 10.3 | 1 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
QLWVTRYHPGE |
| 3253 |
319.1827 | 954.5263 | 954.5134 | 13.5 | 1 | 5 | 1.2 | 1Score > 18 indicates identity |
GNPAVVIRE + Deamidated (NQ) |
| 3340 |
519.2701 | 1036.5256 | 1036.5077 | 17.4 | 1 | 5 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
IYDALKQGE + Deamidated (NQ) |
| 4254 |
1009.1880 | 3024.5422 | 3024.5039 | 12.6 | 1 | 4 | 1.2 | 1Score > 18 indicates identity |
TNPVLQLNLANAYLQGGQPQEAANILNR + 5 Deamidated (NQ) |
| 4067 |
786.7568 | 2357.2486 | 2357.2276 | 8.92 | 1 | 4 | 1.1 | 1Score > 17 indicates identity |
NCGWIRLLPLFMLSLPVQAE + Deamidated (NQ) |
| 3572 |
681.3691 | 1360.7236 | 1360.7351 | -8.39 | 1 | 4 | 0.67 | 1Score > 20 indicates identity Score > 15 indicates homology |
GELLFLIGGNGSGK |
| 4081 |
793.4115 | 2377.2127 | 2377.2529 | -16.9 | 1 | 4 | 1.3 | 1Score > 18 indicates identity |
VIALVNNLGATPLSELYGVYNR + 2 Deamidated (NQ) |
| 3929 |
1057.0638 | 2112.1130 | 2112.0739 | 18.5 | 0 | 4 | 1.4 | 1Score > 18 indicates identity |
VFQSLVGPDLDADGLLEPAR + Deamidated (NQ) |
| 3124 |
354.7019 | 707.3892 | 707.3854 | 5.47 | 0 | 4 | 1.9 | 1Score > 20 indicates identity |
FVSLNK + Deamidated (NQ) |
| 3655 |
497.2777 | 1488.8113 | 1488.8188 | -5.04 | 1 | 4 | 1.5 | 1Score > 18 indicates identity |
QVQAFIGVIAGKQK + 3 Deamidated (NQ) |
| 4068 |
786.7590 | 2357.2552 | 2357.2988 | -18.5 | 1 | 4 | 1 | 1Score > 17 indicates identity |
QSLIDTAMASISLIQLKLQAGR + Deamidated (NQ) |
| 3737 |
790.9209 | 1579.8272 | 1579.8206 | 4.24 | 1 | 4 | 1.7 | 1Score > 19 indicates identity |
IYDDISNGKLSSLR |
| 3757 |
811.9084 | 1621.8022 | 1621.8134 | -6.86 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
HNGEIVPLDDIMLR + Deamidated (NQ) |
| 4025 |
765.4179 | 2293.2319 | 2293.2174 | 6.31 | 1 | 4 | 0.92 | 1Score > 16 indicates identity |
SSLLNLLNVMVDCGFLIKNK + Oxidation (M) |
| 3131 |
375.2335 | 748.4524 | 748.4483 | 5.52 | 1 | 4 | 0.58 | 1Score > 14 indicates identity |
LVDKFK |
| 3226 |
309.5013 | 925.4821 | 925.4803 | 1.86 | 1 | 4 | 1.4 | 1Score > 18 indicates identity |
RAMTIYR + Oxidation (M) |
| 3439 |
386.5586 | 1156.6540 | 1156.6452 | 7.62 | 1 | 4 | 1.8 | 1Score > 19 indicates identity |
AKLQAVLDNGK + Deamidated (NQ) |
| 3873 |
689.7083 | 2066.1031 | 2066.1299 | -13.0 | 0 | 4 | 1.4 | 1Score > 18 indicates identity |
YILADINSDLISLYNIVK |
| 3958 |
710.0374 | 2127.0904 | 2127.1180 | -13.0 | 1 | 4 | 1.9 | 1Score > 19 indicates identity |
DSILLLQMIPLRGCIDDR |
| 3693 |
505.6056 | 1513.7950 | 1513.8001 | -3.38 | 1 | 4 | 0.59 | 1Score > 20 indicates identity Score > 14 indicates homology |
YRNIGISAHIDAGK |
| 3367 |
537.3098 | 1072.6050 | 1072.5877 | 16.2 | 1 | 4 | 2 | 1Score > 19 indicates identity |
SSATTHITKK |
| 4023 |
765.4167 | 2293.2283 | 2293.2140 | 6.21 | 0 | 3 | 1 | 1Score > 16 indicates identity |
KPASLFVASFIGSPAMNLLTGR + Deamidated (NQ); Oxidation (M) |
| 3616 |
720.8606 | 1439.7066 | 1439.6932 | 9.32 | 1 | 3 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
LQAEGLFDQQYK + Deamidated (NQ) |
| 3409 |
559.2564 | 1116.4982 | 1116.5087 | -9.40 | 0 | 3 | 1.8 | 1Score > 19 indicates identity |
WQDIQQLGE + Deamidated (NQ) |
| 3617 |
722.3566 | 1442.6986 | 1442.7188 | -13.9 | 0 | 3 | 0.85 | 1Score > 20 indicates identity Score > 15 indicates homology |
MLQQIVTTAHQR + 2 Deamidated (NQ); Oxidation (M) |
| 3924 |
703.6375 | 2107.8907 | 2107.8536 | 17.6 | 1 | 3 | 0.98 | 1Score > 16 indicates identity |
MYKNIVDGNHQMEPGMPE + 3 Deamidated (NQ); Oxidation (M) |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/