MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Andy1
MS data file : PRT1311_JBEI_1.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 8 Sep 2025 at 17:17:19 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,450

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1–100 (out of 4217)


Page: 1 2 3 4 5 6  43 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3656 497.2787 1488.8143 1488.8188 -3.02 1 18 0.063 +1Score > 18 indicates identity QVQAFIGVIAGKQK + 3 Deamidated (NQ)
3241 473.7482 945.4818 945.4920 -10.7 1 16 0.21 +1Score > 22 indicates identity
Score > 22 indicates homology
SEWANLVK
3243 473.7484 945.4822 945.4655 17.7 1 16 0.11 +1Score > 22 indicates identity
Score > 19 indicates homology
NTLEIVQE + Deamidated (NQ)
3153 801.4562 800.4489 800.4643 -19.3 0 15 0.13 +1Score > 22 indicates identity
Score > 19 indicates homology
LLLSNLE
3571 681.3682 1360.7218 1360.7351 -9.71 1 14 0.079 +1Score > 20 indicates identity
Score > 15 indicates homology
GELLFLIGGNGSGK
3621 483.5637 1447.6693 1447.6476 15.0 1 14 0.22 +1Score > 19 indicates identity FCQALMTELYR + Deamidated (NQ); Oxidation (M)
3581 712.8618 1423.7090 1423.7096 -0.38 1 13 0.28 +1Score > 20 indicates identity
Score > 20 indicates homology
DIEVHVFPDTPR
3620 483.5637 1447.6693 1447.6579 7.85 1 12 0.35 +1Score > 19 indicates identity IDTQDIEASHYR + Deamidated (NQ)
3192 435.7586 869.5026 869.4858 19.3 0 11 0.19 +1Score > 17 indicates identity VAQVQPVK + 2 Deamidated (NQ)
3185 428.7686 855.5226 855.5178 5.69 0 11 0.25 +1Score > 18 indicates identity IALSSLPR
3201 899.5031 898.4958 898.4872 9.58 1 11 0.31 +1Score > 19 indicates identity ELGQSLPR
3973 714.3898 2140.1476 2140.1739 -12.3 1 11 0.18 +1Score > 16 indicates identity LNNALSAIQTTVKPISEIAR + 2 Deamidated (NQ)
3286 328.5141 982.5205 982.5124 8.24 1 11 0.26 +1Score > 18 indicates identity QVKFFADK + Deamidated (NQ)
3543 434.8775 1301.6107 1301.5856 19.2 1 11 0.16 +1Score > 20 indicates identity
Score > 15 indicates homology
HQGLATEVMCR + Deamidated (NQ)
3584 475.5770 1423.7092 1423.7168 -5.33 1 11 0.49 +1Score > 20 indicates identity GAAPPGQKGQANATR + Deamidated (NQ)
3570 681.3681 1360.7216 1360.7351 -9.86 1 11 0.12 +1Score > 20 indicates identity
Score > 14 indicates homology
GELLFLIGGNGSGK
4133 834.0765 2499.2077 2499.2540 -18.5 1 10 0.5 +1Score > 19 indicates identity QDSRMLLATQHSATGQVTQWIK + Deamidated (NQ)
3287 328.5143 982.5211 982.5124 8.85 1 10 0.35 +1Score > 18 indicates identity QVKFFADK + Deamidated (NQ)
3206 455.2355 908.4564 908.4459 11.6 0 9 0.58 +1Score > 19 indicates identity LMTLMQR + Deamidated (NQ); Oxidation (M)
4164 858.4039 2572.1899 2572.2227 -12.8 1 9 0.35 +1Score > 17 indicates identity SPAAQRLLNTTAGMDPAWDAAIQR + 3 Deamidated (NQ); Oxidation (M)
4124 824.0731 2469.1975 2469.2176 -8.14 1 9 0.65 +1Score > 20 indicates identity RALAYISSIIQAGDGGAPAFYQAE + Deamidated (NQ)
3275 327.2079 978.6019 978.5974 4.54 1 9 0.16 +1Score > 13 indicates identity KPAVPPSKR
3205 455.2351 908.4556 908.4459 10.7 0 9 0.65 +1Score > 19 indicates identity LMTLMQR + Deamidated (NQ); Oxidation (M)
3217 458.7391 915.4636 915.4484 16.7 0 9 0.31 +1Score > 22 indicates identity
Score > 16 indicates homology
MQQAVPDK
3397 547.2776 1092.5406 1092.5419 -1.17 1 9 0.2 +1Score > 21 indicates identity
Score > 14 indicates homology
NAARMAALMK + Deamidated (NQ); Oxidation (M)
3270 487.7459 973.4772 973.4869 -9.89 1 9 0.2 +1Score > 22 indicates identity
Score > 14 indicates homology
IDHYLGKE
4290 820.9520 3279.7789 3279.7213 17.6 1 8 0.2 +1Score > 14 indicates identity WGVGLTFLLAATSVMAKDIQLLNVSYDPTR + Deamidated (NQ)
3743 527.9507 1580.8303 1580.8383 -5.07 1 8 0.69 +1Score > 19 indicates identity DIPVNQLSAGQQRR
3191 435.7584 869.5022 869.4858 18.9 0 8 0.43 +1Score > 17 indicates identity VAQVQPVK + 2 Deamidated (NQ)
3369 358.5424 1072.6054 1072.6029 2.29 0 8 0.72 +1Score > 19 indicates identity QLGYPGAVLR
3071 623.3261 622.3188 622.3174 2.32 0 8 0.9 +1Score > 20 indicates identity LSTTTT
3099 667.3012 666.2939 666.2973 -5.02 1 8 0.89 +1Score > 20 indicates identity YEAQR + Deamidated (NQ)
3500 415.5483 1243.6231 1243.6408 -14.3 0 8 0.52 +1Score > 20 indicates identity
Score > 17 indicates homology
VQQDGSQVLLR + 2 Deamidated (NQ)
3294 492.2682 982.5218 982.5236 -1.79 1 7 0.53 +1Score > 17 indicates identity KFSPVSYR
3864 1030.0277 2058.0408 2058.0190 10.6 0 7 0.24 +1Score > 20 indicates identity
Score > 14 indicates homology
ANAATGNLNILLPMVTSLDE + 2 Deamidated (NQ)
3101 667.3022 666.2949 666.2973 -3.52 1 7 1 +1Score > 20 indicates identity
Score > 20 indicates homology
YEAQR + Deamidated (NQ)
3599 712.8629 1423.7112 1423.7017 6.72 1 7 1 +1Score > 20 indicates identity
Score > 20 indicates homology
QVFMAKNADSALK + 2 Deamidated (NQ)
3786 852.8840 1703.7534 1703.7234 17.6 1 7 0.74 +1Score > 18 indicates identity ATANNGQQQQVQEQR + 5 Deamidated (NQ)
3176 416.2503 830.4860 830.4974 -13.7 1 7 0.73 +1Score > 18 indicates identity ISVTQKR
3290 492.2681 982.5216 982.5092 12.7 1 7 0.62 +1Score > 17 indicates identity KCLFLMR + Oxidation (M)
3580 712.8617 1423.7088 1423.6943 10.2 1 7 0.83 +1Score > 20 indicates identity
Score > 18 indicates homology
VQYQVDGQTKTR + 2 Deamidated (NQ)
3585 712.8619 1423.7092 1423.7096 -0.24 1 7 0.29 +1Score > 20 indicates identity
Score > 14 indicates homology
DIEVHVFPDTPR
3763 546.9590 1637.8552 1637.8236 19.3 1 7 0.97 +1Score > 19 indicates identity YSYVMHLVSRVVGE
4078 792.7450 2375.2132 2375.1753 16.0 1 6 0.94 +1Score > 19 indicates identity TPVFNTLPMMGKASPVSLGVPSE + Deamidated (NQ); Oxidation (M)
3756 811.9075 1621.8004 1621.8134 -7.97 1 6 1 +1Score > 20 indicates identity
Score > 19 indicates homology
HNGEIVPLDDIMLR + Deamidated (NQ)
3827 967.0117 1932.0088 1931.9961 6.59 1 6 0.74 +1Score > 18 indicates identity VMRDMVYNLPVLTPPR + 2 Oxidation (M)
3562 665.3706 1328.7266 1328.7187 5.97 1 6 1 +1Score > 20 indicates identity
Score > 19 indicates homology
NLDLDSIIAEVK
3951 708.3014 2121.8824 2121.8540 13.3 1 6 0.24 +1Score > 13 indicates identity YMMDQNNIGSGSTVAELME + Deamidated (NQ); 2 Oxidation (M)
4099 602.0965 2404.3569 2404.3186 15.9 1 6 0.23 +1Score > 13 indicates identity QTSGVQQQIRQALSALPLPVNR + Deamidated (NQ)
3135 376.2344 750.4542 750.4613 -9.36 1 6 0.24 +1Score > 13 indicates identity LGRLHR
4151 849.0729 2544.1969 2544.2094 -4.91 1 6 0.92 +1Score > 18 indicates identity QWVLPQTNMGYYSELLTTLQR + 4 Deamidated (NQ)
3100 334.1545 666.2944 666.2861 12.6 0 6 1 +1Score > 20 indicates identity
Score > 19 indicates homology
FVSQGE + Deamidated (NQ)
3152 801.4550 800.4477 800.4392 10.6 0 6 0.35 +1Score > 21 indicates identity
Score > 14 indicates homology
LQDIGVR + Deamidated (NQ)
3289 492.2680 982.5214 982.5236 -2.20 1 6 0.88 +1Score > 18 indicates identity KFSPVSYR
3533 639.8355 1277.6564 1277.6359 16.1 0 6 1 +1Score > 20 indicates identity
Score > 18 indicates homology
LVGANIAMDMVK + Deamidated (NQ); Oxidation (M)
3078 319.6919 637.3692 637.3660 5.10 0 6 0.42 +1Score > 14 indicates identity VVAHGR
4252 1008.8519 3023.5339 3023.5195 4.76 0 6 0.65 +1Score > 16 indicates identity ALANSPAADVPLPDLIITCNNICNTLLK + 3 Deamidated (NQ)
3438 579.3338 1156.6530 1156.6465 5.64 1 6 1.2 +1Score > 19 indicates identity VLQHFTRTR
4029 767.7296 2300.1670 2300.1900 -10.00 0 5 1.1 +1Score > 18 indicates identity QIIGADGLIFQDLNDLIDAVR + 2 Deamidated (NQ)
3647 366.6724 1462.6605 1462.6735 -8.92 1 5 1.2 +1Score > 19 indicates identity SNHAGTTPMGYRR + Oxidation (M)
4102 805.7488 2414.2246 2414.2726 -19.9 1 5 1.1 +1Score > 18 indicates identity IGAGNVTKLANQVIVALNIAAMSE + 2 Deamidated (NQ); Oxidation (M)
3660 497.5669 1489.6789 1489.6759 2.00 0 5 1 +1Score > 20 indicates identity
Score > 18 indicates homology
DSSFINNITFGMK + Deamidated (NQ); Oxidation (M)
3600 712.8633 1423.7120 1423.7096 1.72 1 5 1 +1Score > 20 indicates identity
Score > 18 indicates homology
DIEVHVFPDTPR
3972 1071.0730 2140.1314 2140.0913 18.8 1 5 0.82 +1Score > 17 indicates identity NSGAELGKPVTIGNNVWIGGR + 2 Deamidated (NQ)
3945 707.3662 2119.0768 2119.0480 13.6 1 5 1.4 +1Score > 19 indicates identity GGSPLMVYSRQQQQALAQR + 2 Deamidated (NQ)
3330 1027.5713 1026.5640 1026.5570 6.81 1 5 1.3 +1Score > 19 indicates identity QAKTSTVHR
4215 926.1664 2775.4774 2775.4550 8.05 1 5 0.78 +1Score > 16 indicates identity RLMMVALLVIAPLSAATAADQTNPYK + 2 Deamidated (NQ); Oxidation (M)
3618 724.8406 1447.6666 1447.6799 -9.17 1 5 1.5 +1Score > 19 indicates identity SQPPSMESAMVLR + Oxidation (M)
3963 713.3592 2137.0558 2137.0692 -6.26 0 5 1.5 +1Score > 19 indicates identity GQVVSPVNFNSPGQVVIAGHK + 4 Deamidated (NQ)
3292 492.2681 982.5216 982.5196 2.12 1 5 1 +1Score > 17 indicates identity RQAQHTLK + 2 Deamidated (NQ)
3347 523.7588 1045.5030 1045.5226 -18.7 0 5 1 +1Score > 22 indicates identity
Score > 17 indicates homology
VTSCLVNPR + Deamidated (NQ)
3499 415.5480 1243.6222 1243.6408 -15.0 1 5 0.89 +1Score > 20 indicates identity
Score > 17 indicates homology
LNSNLNLVARE + 2 Deamidated (NQ)
4438 955.9199 6684.3884 6684.4507 -9.33 1 5 0.34 +1Score > 13 indicates identity QLISHFAVIFFPLLPALISGGLILGFRNVIGDLPMSNGQTLAQMYPSLQTIYDFLWLIGE + 5 Deamidated (NQ); 2 Oxidation (M)
3398 366.8545 1097.5417 1097.5506 -8.09 1 5 0.98 +1Score > 20 indicates identity
Score > 17 indicates homology
GVYNDQFKK
3575 693.3588 1384.7030 1384.6888 10.3 1 5 1 +1Score > 20 indicates identity
Score > 17 indicates homology
QLWVTRYHPGE
3253 319.1827 954.5263 954.5134 13.5 1 5 1.2 +1Score > 18 indicates identity GNPAVVIRE + Deamidated (NQ)
3340 519.2701 1036.5256 1036.5077 17.4 1 5 1 +1Score > 21 indicates identity
Score > 17 indicates homology
IYDALKQGE + Deamidated (NQ)
4254 1009.1880 3024.5422 3024.5039 12.6 1 4 1.2 +1Score > 18 indicates identity TNPVLQLNLANAYLQGGQPQEAANILNR + 5 Deamidated (NQ)
4067 786.7568 2357.2486 2357.2276 8.92 1 4 1.1 +1Score > 17 indicates identity NCGWIRLLPLFMLSLPVQAE + Deamidated (NQ)
3572 681.3691 1360.7236 1360.7351 -8.39 1 4 0.67 +1Score > 20 indicates identity
Score > 15 indicates homology
GELLFLIGGNGSGK
4081 793.4115 2377.2127 2377.2529 -16.9 1 4 1.3 +1Score > 18 indicates identity VIALVNNLGATPLSELYGVYNR + 2 Deamidated (NQ)
3929 1057.0638 2112.1130 2112.0739 18.5 0 4 1.4 +1Score > 18 indicates identity VFQSLVGPDLDADGLLEPAR + Deamidated (NQ)
3124 354.7019 707.3892 707.3854 5.47 0 4 1.9 +1Score > 20 indicates identity FVSLNK + Deamidated (NQ)
3655 497.2777 1488.8113 1488.8188 -5.04 1 4 1.5 +1Score > 18 indicates identity QVQAFIGVIAGKQK + 3 Deamidated (NQ)
4068 786.7590 2357.2552 2357.2988 -18.5 1 4 1 +1Score > 17 indicates identity QSLIDTAMASISLIQLKLQAGR + Deamidated (NQ)
3737 790.9209 1579.8272 1579.8206 4.24 1 4 1.7 +1Score > 19 indicates identity IYDDISNGKLSSLR
3757 811.9084 1621.8022 1621.8134 -6.86 1 4 1 +1Score > 20 indicates identity
Score > 16 indicates homology
HNGEIVPLDDIMLR + Deamidated (NQ)
4025 765.4179 2293.2319 2293.2174 6.31 1 4 0.92 +1Score > 16 indicates identity SSLLNLLNVMVDCGFLIKNK + Oxidation (M)
3131 375.2335 748.4524 748.4483 5.52 1 4 0.58 +1Score > 14 indicates identity LVDKFK
3226 309.5013 925.4821 925.4803 1.86 1 4 1.4 +1Score > 18 indicates identity RAMTIYR + Oxidation (M)
3439 386.5586 1156.6540 1156.6452 7.62 1 4 1.8 +1Score > 19 indicates identity AKLQAVLDNGK + Deamidated (NQ)
3873 689.7083 2066.1031 2066.1299 -13.0 0 4 1.4 +1Score > 18 indicates identity YILADINSDLISLYNIVK
3958 710.0374 2127.0904 2127.1180 -13.0 1 4 1.9 +1Score > 19 indicates identity DSILLLQMIPLRGCIDDR
3693 505.6056 1513.7950 1513.8001 -3.38 1 4 0.59 -1Score > 20 indicates identity
Score > 14 indicates homology
YRNIGISAHIDAGK
3367 537.3098 1072.6050 1072.5877 16.2 1 4 2 +1Score > 19 indicates identity SSATTHITKK
4023 765.4167 2293.2283 2293.2140 6.21 0 3 1 +1Score > 16 indicates identity KPASLFVASFIGSPAMNLLTGR + Deamidated (NQ); Oxidation (M)
3616 720.8606 1439.7066 1439.6932 9.32 1 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
LQAEGLFDQQYK + Deamidated (NQ)
3409 559.2564 1116.4982 1116.5087 -9.40 0 3 1.8 +1Score > 19 indicates identity WQDIQQLGE + Deamidated (NQ)
3617 722.3566 1442.6986 1442.7188 -13.9 0 3 0.85 +1Score > 20 indicates identity
Score > 15 indicates homology
MLQQIVTTAHQR + 2 Deamidated (NQ); Oxidation (M)
3924 703.6375 2107.8907 2107.8536 17.6 1 3 0.98 +1Score > 16 indicates identity MYKNIVDGNHQMEPGMPE + 3 Deamidated (NQ); Oxidation (M)
Page: 1 2 3 4 5 6  43 Next 

Not what you expected? Try the select summary.