MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Andy1
MS data file : PRT1311_JBEI_1.mgf
Database : Ecoli-MetEng 20200720 (4,900 sequences; 1,661,431 residues)
Timestamp : 8 Sep 2025 at 17:17:19 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,450

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 1–10 (out of 14)


Page: 1 2 Next 

-1

Accession Score Description
1 Q88JG7_PSEPK 2537 Fe-containing alcohol dehydrogenase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=yiaY PE=3 SV=1
Score Mass Matches Sequences emPAI
1.1 Q88JG7_PSEPK 2537 44735 113 (90) 15 (14) 3.27
Fe-containing alcohol dehydrogenase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=yiaY PE=3 SV=1

-113 peptide matches (38 non-duplicate, 75 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
3022   551.2963 550.2890 550.2863 4.87 0 14 0.15 +1Score > 18 indicates identity U K.TFGAR.K
3107 +1 340.1993 678.3840 678.3813 4.05 1 24 0.0047 +1Score > 13 indicates identity U K.TFGARK.V
3108 +4 340.7041 679.3936 679.3905 4.67 0 34 0.00048 +1Score > 13 indicates identity U K.FSIVSK.A
3113 +2 680.4015 679.3942 679.3905 5.52 0 16 0.028 +1Score > 13 indicates identity U K.FSIVSK.A
3184 +1 425.7874 849.5602 849.5548 6.38 1 25 0.003 +1Score > 13 indicates identity U E.HLIALKR.A
3214 +3 458.7372 915.4598 915.4562 3.94 0 59 3.8e-006 +1Score > 21 indicates identity
Score > 17 indicates homology
U R.HNVANYAK.T
3249 +3 319.1825 954.5257 954.5208 5.07 1 41 0.00028 +1Score > 18 indicates identity U R.MKFSIVSK.A + Oxidation (M)
3251 +3 478.2703 954.5260 954.5208 5.47 1 58 5.3e-006 +1Score > 18 indicates identity U R.MKFSIVSK.A + Oxidation (M)
3299 +5 331.5397 991.5973 991.5927 4.61 0 44 4e-005 +1Score > 13 indicates identity U K.AIGIVVAHGR.S
3304 +3 496.8063 991.5980 991.5927 5.40 0 69 1.2e-007 +1Score > 13 indicates identity U K.AIGIVVAHGR.S
3336 +2 345.8920 1034.6542 1034.6488 5.20 1 35 0.00031 +1Score > 13 indicates identity U R.LVEHLIALK.R
3338   518.3347 1034.6548 1034.6488 5.86 1 16 0.024 +1Score > 13 indicates identity U R.LVEHLIALK.R
3526 +5 639.8325 1277.6504 1277.6438 5.19 1 82 3.4e-008 +1Score > 21 indicates identity
Score > 19 indicates homology
U K.VIAEVFGIDCR.G
3527 +1 426.8908 1277.6506 1277.6438 5.29 1 24 0.0058 +1Score > 21 indicates identity
Score > 15 indicates homology
U K.VIAEVFGIDCR.G
3628 +5 726.8727 1451.7308 1451.7231 5.32 1 69 8.4e-007 +1Score > 20 indicates identity U K.FVSPEIIFGAGCR.H
3630 +3 484.9180 1451.7322 1451.7231 6.23 1 43 0.00029 +1Score > 20 indicates identity U K.FVSPEIIFGAGCR.H
3671 +1 753.9164 1505.8182 1505.8103 5.28 1 38 0.00043 +1Score > 17 indicates identity U R.AIGFHETLGLHGVR.T
3678 +7 377.4620 1505.8189 1505.8103 5.71 1 45 7.9e-005 +1Score > 16 indicates identity U R.AIGFHETLGLHGVR.T
3679 +6 502.9470 1505.8192 1505.8103 5.89 1 53 1.3e-005 +1Score > 16 indicates identity U R.AIGFHETLGLHGVR.T
3869 +1 1034.0526 2066.0906 2066.1194 -13.9 1 2 1.9 +1Score > 18 indicates identity U R.LINGNLVEMIANPTDIALR.E
3870 +2 689.7071 2066.0995 2066.1194 -9.63 1 22 0.023 +1Score > 18 indicates identity U R.LINGNLVEMIANPTDIALR.E
3876 +1 1042.5660 2083.1174 2083.0983 9.19 1 114 8.4e-012 +1Score > 16 indicates identity U R.LINGNLVEMIANPTDIALR.E + Deamidated (NQ); Oxidation (M)
3877 +1 1042.5665 2083.1184 2083.0983 9.67 1 119 2.7e-012 +1Score > 16 indicates identity U R.LINGNLVEMIANPTDIALR.E + Deamidated (NQ); Oxidation (M)
3878 +4 695.3801 2083.1185 2083.0983 9.69 1 79 2.9e-008 +1Score > 16 indicates identity U R.LINGNLVEMIANPTDIALR.E + Deamidated (NQ); Oxidation (M)
3884   1043.0641 2084.1136 2084.0823 15.0 1 92 1.5e-009 +1Score > 16 indicates identity U R.LINGNLVEMIANPTDIALR.E + 2 Deamidated (NQ); Oxidation (M)
3885   695.7122 2084.1148 2084.0823 15.6 1 67 4.8e-007 +1Score > 16 indicates identity U R.LINGNLVEMIANPTDIALR.E + 2 Deamidated (NQ); Oxidation (M)
3887   695.7132 2084.1178 2084.0823 17.0 1 32 0.0014 +1Score > 16 indicates identity U R.LINGNLVEMIANPTDIALR.E + 2 Deamidated (NQ); Oxidation (M)
3888 +1 1043.0674 2084.1202 2084.0823 18.2 1 28 0.0031 +1Score > 16 indicates identity U R.LINGNLVEMIANPTDIALR.E + 2 Deamidated (NQ); Oxidation (M)
3932   706.3154 2115.9244 2115.9136 5.07 0 25 0.0083 +1Score > 17 indicates identity U R.QNHCDVIVAVGGGSPMDCGK.A + Oxidation (M)
3933 +1 706.6497 2116.9273 2116.8976 14.0 0 50 3e-005 +1Score > 17 indicates identity U R.QNHCDVIVAVGGGSPMDCGK.A + Deamidated (NQ); Oxidation (M)
4140   843.7420 2528.2042 2528.1676 14.5 0 9 0.45 +1Score > 18 indicates identity U R.TSDIPFLSQHAMDDPCILTNPR.A + Deamidated (NQ)
4145   636.8063 2543.1961 2543.1785 6.93 0 6 0.9 +1Score > 18 indicates identity U R.TSDIPFLSQHAMDDPCILTNPR.A + Oxidation (M)
4148 +2 849.0721 2544.1945 2544.1625 12.6 0 57 7.1e-006 +1Score > 18 indicates identity U R.TSDIPFLSQHAMDDPCILTNPR.A + Deamidated (NQ); Oxidation (M)
4150 +1 637.0563 2544.1961 2544.1625 13.2 0 16 0.1 +1Score > 18 indicates identity U R.TSDIPFLSQHAMDDPCILTNPR.A + Deamidated (NQ); Oxidation (M)
4153   849.4058 2545.1956 2545.1465 19.3 0 11 0.36 +1Score > 19 indicates identity U R.TSDIPFLSQHAMDDPCILTNPR.A + 2 Deamidated (NQ); Oxidation (M)
4284 +5 1093.9335 3278.7787 3278.7398 11.8 1 65 4e-007 +1Score > 13 indicates identity U R.VPSPPLILIPTTAGTSADVSQFVIISNQQER.M + Deamidated (NQ)
D:\Xcalibur\Data\Jennifer\PRT1311 Andy\PRT1311_JBEI_1.raw

Score > 13 indicates identity

4286 +1 820.7023 3278.7801 3278.7398 12.3 1 43 6.1e-005 -1Score > 13 indicates identity U R.VPSPPLILIPTTAGTSADVSQFVIISNQQER.M + Deamidated (NQ)
12.3 1 27 0.0026 2 R.VPSPPLILIPTTAGTSADVSQFVIISNQQER.M + Deamidated (NQ)
12.3 1 21 0.011 3 R.VPSPPLILIPTTAGTSADVSQFVIISNQQER.M + Deamidated (NQ)
12.3 1 21 0.011 3 R.VPSPPLILIPTTAGTSADVSQFVIISNQQER.M + Deamidated (NQ)
13.0 1 4 0.46 5 WGVGLTFLLAATSVMAKDIQLLNVSYDPTR  
4291   1094.2677 3279.7813 3279.7238 17.5 1 47 2.8e-005 +1Score > 13 indicates identity U R.VPSPPLILIPTTAGTSADVSQFVIISNQQER.M + 2 Deamidated (NQ)

+2

Accession Score Description
1 Q88JG6_PSEPK 262 histidine kinase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=PP_2683 PE=4 SV=2

+3

Accession Score Description
1 TOLB_ECOLI 239 Protein TolB OS=Escherichia coli (strain K12) GN=tolB PE=1 SV=1

+4

Accession Score Description
1 EFTU1_ECOLI 221 Elongation factor Tu 1 OS=Escherichia coli (strain K12) GN=tufA PE=1 SV=1

+5

Accession Score Description
1 TRYP_PIG 218 Trypsin OS=Sus scrofa PE=1 SV=1

+6

Accession Score Description
1 Q70I01_9ACTO 133 Borrelidin polyketide synthase, type I OS=Streptomyces parvulus GN=borA2 PE=4 SV=1

+7

Accession Score Description
1 DNAJ_ECOLI 102 Chaperone protein DnaJ OS=Escherichia coli (strain K12) GN=dnaJ PE=1 SV=3

+8

Accession Score Description
1 RECA_ECOLI 61 Protein RecA OS=Escherichia coli (strain K12) GN=recA PE=1 SV=2

+9

Accession Score Description
1 K2C1_HUMAN 52 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6

+10

Accession Score Description
1 YBBD_ECOLI 49 description
Page: 1 2 Next 

Not what you expected? Try the select summary.