MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita6 sp
MS data file : PRT1270_T-BRSC_6_20250714122635.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 23:38:56 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,869

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 2701–2800 (out of 3786)

Page: Previous 1 …23 24 25 26 27 28 29 30 31 32 33 … 38 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
4719 991.5483 3962.1641 3962.1298 8.65 1 2 1 +1Score > 29 indicates identity
Score > 14 indicates homology		 LAKQLHQQQHQLQLQLQQIKPKPISSMISQPVNK + 5 Deamidated (NQ)
3993 514.0707 2565.3171 2565.3045 4.92 0 2 0.8 +1Score > 37 indicates identity
Score > 13 indicates homology		 TPTYMNIMLAFTISLLGMLTYR + Oxidation (M)
4720 797.4336 3982.1316 3982.1457 -3.53 1 2 0.8 +1Score > 30 indicates identity
Score > 13 indicates homology		 FDFDATLPLMALQFVLLAIILNAIFYKPLNKALDE + 2 Deamidated (NQ)
3945 837.1094 2508.3064 2508.3298 -9.34 1 2 1 +1Score > 37 indicates identity
Score > 14 indicates homology		 VVWLEINTQPGMTPTSLVPDIAK
3842 805.1296 2412.3670 2412.3740 -2.93 1 2 1 +1Score > 30 indicates identity
Score > 14 indicates homology		 IGADVITAPPAVIKGLANHVLTDK
3894 616.0801 2460.2913 2460.2570 14.0 0 2 0.88 +1Score > 36 indicates identity
Score > 14 indicates homology		 NSVSWSAIIAGCVQNNLLSLALK + 3 Deamidated (NQ)
4363 1013.5148 3037.5226 3037.4652 18.9 1 2 0.79 +1Score > 36 indicates identity
Score > 13 indicates homology		 HTWLMLSSWPLAMMWFISTLAETNR + Oxidation (M)
3369 529.5408 2114.1341 2114.1695 -16.7 1 2 0.85 +1Score > 37 indicates identity
Score > 14 indicates homology		 SISNRTLLLAALADGTTQIR + Deamidated (NQ)
4330 997.5330 2989.5772 2989.5814 -1.42 1 2 1 +1Score > 34 indicates identity
Score > 14 indicates homology		 FDLNVSKSAWLTAIPLAQQFWQTVAR
4409 778.9252 3111.6717 3111.6454 8.46 0 2 0.7 +1Score > 32 indicates identity
Score > 13 indicates homology		 IVSSLVNNIIMPFVGVLLGGLDFSDLSFK + 2 Deamidated (NQ); Oxidation (M)
3074 636.3431 1906.0075 1906.0095 -1.05 0 2 0.98 +1Score > 38 indicates identity
Score > 14 indicates homology		 MVVAAAGNVDHDGLVALVR
3311 693.4183 2077.2331 2077.2074 12.3 1 2 1 +1Score > 26 indicates identity
Score > 14 indicates homology		 FINILSNLLQKGTLIFIK + 3 Deamidated (NQ)
3983 852.1157 2553.3253 2553.2810 17.4 1 2 0.95 +1Score > 36 indicates identity
Score > 14 indicates homology		 VLSPLLNLVQGLSSPDNTVRNDAE + 3 Deamidated (NQ)
4563 836.2041 3340.7873 3340.7426 13.4 1 2 1 +1Score > 32 indicates identity
Score > 14 indicates homology		 GGQTAAIIFLFVSMLMYFISAMVSLKLWR + 3 Oxidation (M)
4245 961.1337 2880.3793 2880.4163 -12.9 0 2 0.76 +1Score > 37 indicates identity
Score > 13 indicates homology		 TPMMHPIPGGANAKPFITHHNALGVDR + 2 Deamidated (NQ)
4602 687.3540 3431.7336 3431.6820 15.0 1 2 0.96 +1Score > 35 indicates identity
Score > 14 indicates homology		 SYQVFHAGNAMHNGGLLGQGLGLGQIKLGFLSE + 3 Deamidated (NQ); Oxidation (M)
3866 808.4634 2422.3684 2422.4096 -17.0 0 2 1 +1Score > 30 indicates identity
Score > 14 indicates homology		 LAILLFALCIVFTMLTTLVVR + Oxidation (M)
2622 412.7466 1646.9573 1646.9389 11.2 1 2 1 +1Score > 31 indicates identity
Score > 14 indicates homology		 TIMLLGVSSQKISVR + Oxidation (M)
4038 878.4547 2632.3423 2632.2930 18.7 1 2 1 +1Score > 37 indicates identity
Score > 14 indicates homology		 ILNLCNQSFIPAFFQAHMAHKK + 2 Deamidated (NQ); Oxidation (M)
4400 1030.8997 3089.6773 3089.6278 16.0 1 2 1 +1Score > 31 indicates identity
Score > 14 indicates homology		 TATMALSTLAALIQISGAKNITLSPDQTSR + Deamidated (NQ); Oxidation (M)
4603 859.1844 3432.7085 3432.6734 10.2 1 2 0.87 +1Score > 35 indicates identity
Score > 14 indicates homology		 DVFPCTPMQEALVALSLIPGAQASYALHAAFE + Oxidation (M)
3187 995.0340 1988.0534 1988.0367 8.43 1 2 0.9 +1Score > 38 indicates identity
Score > 14 indicates homology		 FLEQAQQVSGLLAQLWR + 2 Deamidated (NQ)
3325 696.3710 2086.0912 2086.0504 19.6 0 2 0.88 +1Score > 38 indicates identity
Score > 14 indicates homology		 ALGADAILIIVAALDDGQMAE + Deamidated (NQ); Oxidation (M)
4053 883.1306 2646.3700 2646.3177 19.8 1 2 1 +1Score > 36 indicates identity
Score > 14 indicates homology		 QDQVLNAYNVGPLPTTFLIDKNGE + Deamidated (NQ)
4821 1009.5370 5042.6486 5042.5490 19.8 1 2 0.7 +1Score > 28 indicates identity
Score > 13 indicates homology		 LFLLLITFIALFGAINAFSGVDISQGSSVGDFQCMLNQGFEFAIIR + 3 Deamidated (NQ)
3887 817.4261 2449.2565 2449.2860 -12.0 1 2 1 +1Score > 38 indicates identity
Score > 14 indicates homology		 MSLFNVSNGLRTALRPSVASSSR
4029 873.0865 2616.2377 2616.2490 -4.32 1 2 0.81 +1Score > 38 indicates identity
Score > 13 indicates homology		 SLGQRHYDVQLIGGMVLNDGNIAE + 2 Deamidated (NQ); Oxidation (M)
4342 1004.1927 3009.5563 3009.5294 8.91 1 2 0.89 +1Score > 35 indicates identity
Score > 14 indicates homology		 ILAASFNKAINNIVASFSSVNDAITQTAE + Deamidated (NQ)
4390 771.1429 3080.5425 3080.5376 1.60 0 2 0.76 +1Score > 36 indicates identity
Score > 13 indicates homology		 RPQQPNPPSAPLVPGLLDQSNPLSTPMPK + 5 Deamidated (NQ)
623 765.4019 764.3946 764.3851 12.5 1 2 0.87 +1Score > 42 indicates identity
Score > 14 indicates homology		 MTKVDR + Oxidation (M)
4160 557.0812 2780.3696 2780.3651 1.64 1 2 0.98 +1Score > 38 indicates identity
Score > 14 indicates homology		 GATGPEGVLPRPLLSCTQALDDDLQR + 2 Deamidated (NQ)
3445 717.3847 2149.1323 2149.1743 -19.5 0 2 0.74 +1Score > 37 indicates identity
Score > 13 indicates homology		 VGVITSASGAALHDILQVLQR + 2 Deamidated (NQ)
4111 907.5363 2719.5871 2719.5995 -4.57 1 2 1 +1Score > 26 indicates identity
Score > 14 indicates homology		 LTLGVNLLQMLSLSKIPSLPLPMLK + Deamidated (NQ)
4189 938.1489 2811.4249 2811.3774 16.9 1 2 1 +1Score > 37 indicates identity
Score > 14 indicates homology		 QASVSITPAGQLLVTVRAPASDGQANQE + 4 Deamidated (NQ)
1138 496.7820 991.5494 991.5484 1.01 1 2 0.75 +1Score > 39 indicates identity
Score > 13 indicates homology		 VVTKAMATR + Oxidation (M)
4334 998.4989 2992.4749 2992.4272 15.9 1 2 1 +1Score > 37 indicates identity
Score > 14 indicates homology		 IQINAFAEQTPVVMAPNMSVGVNLMWK + 5 Deamidated (NQ)
4345 755.3862 3017.5157 3017.5388 -7.65 1 2 0.83 +1Score > 36 indicates identity
Score > 13 indicates homology		 AVSMIPPLLLNVNPDHKILDMCAAPGSK + Deamidated (NQ); Oxidation (M)
4476 801.9282 3203.6837 3203.6622 6.71 1 2 0.98 +1Score > 34 indicates identity
Score > 14 indicates homology		 QIHQLQKVAHGFLIGSSLMGNQDLNNAVR + Oxidation (M)
2786 865.4761 1728.9376 1728.9154 12.9 0 2 0.99 +1Score > 38 indicates identity
Score > 14 indicates homology		 VTMINAIPMASLDPIK + Oxidation (M)
3731 463.8564 2314.2456 2314.2130 14.1 1 2 0.78 +1Score > 35 indicates identity
Score > 13 indicates homology		 MVVANPILVQADIDFLLGELE + Oxidation (M)
3892 818.7518 2453.2336 2453.2545 -8.54 1 2 0.81 +1Score > 38 indicates identity
Score > 13 indicates homology		 ALLSNPEMLLMDEPLSALDLPR + Oxidation (M)
4838 916.9814 5495.8447 5495.7419 18.7 1 2 1 +1Score > 27 indicates identity
Score > 14 indicates homology		 YVAVCRPLHYVVIMNYWFCLRMAAFSWLIGFGNSVLQSSLTLNMPR + Oxidation (M)
3558 735.3568 2203.0486 2203.0925 -19.9 1 2 1 +1Score > 39 indicates identity
Score > 14 indicates homology		 MQWVKLTLHFPSFFSYR + Deamidated (NQ); Oxidation (M)
3160 658.3741 1972.1005 1972.1139 -6.81 1 2 1 +1Score > 34 indicates identity
Score > 14 indicates homology		 RPILSVSLSDGTSKIMLR
4130 917.1358 2748.3856 2748.4082 -8.24 1 2 0.71 +1Score > 37 indicates identity
Score > 13 indicates homology		 TVTELILQHQNPQQLSSNLWAAVR + 3 Deamidated (NQ)
4066 891.8154 2672.4244 2672.4103 5.25 1 2 1 +1Score > 34 indicates identity
Score > 14 indicates homology		 VLMHFLNMGLPMKPSILVQKQSK + 2 Deamidated (NQ); 2 Oxidation (M)
4376 765.1695 3056.6489 3056.6508 -0.62 1 2 1 +1Score > 32 indicates identity
Score > 14 indicates homology		 ESALVMNNVLLAVAALVVFTGTVWPLIAE + Deamidated (NQ); Oxidation (M)
4071 892.7881 2675.3425 2675.3112 11.7 0 2 0.72 +1Score > 38 indicates identity
Score > 13 indicates homology		 AGTYGITMQQISNTLGSFLSGATVTR + 2 Deamidated (NQ)
4075 895.4594 2683.3564 2683.3858 -11.0 1 2 0.92 +1Score > 37 indicates identity
Score > 14 indicates homology		 GPAALPWGDLGVDVVVESTGLFTNAAK
4594 854.2415 3412.9369 3412.8794 16.8 1 2 1 +1Score > 25 indicates identity
Score > 14 indicates homology		 MVFGENLLILYLPSIVITLANFITPMIFAK + 2 Oxidation (M)
2752 429.2128 1712.8221 1712.7992 13.4 1 2 0.82 +1Score > 40 indicates identity
Score > 13 indicates homology		 NSVTTTPVEAPPQIQE + 3 Deamidated (NQ)
2185 728.4356 1454.8566 1454.8344 15.3 1 2 1 +1Score > 33 indicates identity
Score > 14 indicates homology		 GGKTIGAGIIIDLIN + Deamidated (NQ)
4335 998.4996 2992.4770 2992.5256 -16.2 1 2 0.77 +1Score > 37 indicates identity
Score > 13 indicates homology		 FIPGMLTNPNLSNYLEVDLLFVVDPR + Deamidated (NQ); Oxidation (M)
2562 809.4410 1616.8674 1616.8774 -6.12 1 2 0.96 +1Score > 39 indicates identity
Score > 14 indicates homology		 TNEIVDFLLANIVR + Deamidated (NQ)
4047 661.0837 2640.3057 2640.3406 -13.2 1 2 1 +1Score > 38 indicates identity
Score > 14 indicates homology		 MKFSCGFLLIFLVLSAMIATFSE + Oxidation (M)
3853 806.7508 2417.2306 2417.2226 3.28 1 2 0.82 +1Score > 38 indicates identity
Score > 13 indicates homology		 NPLQFLGQFLLDANANQQKQK + 3 Deamidated (NQ)
3339 524.7821 2095.0993 2095.1282 -13.8 0 1 0.74 +1Score > 38 indicates identity
Score > 13 indicates homology		 QVHVLDIGTGTGILAMMALR
3833 801.4586 2401.3540 2401.3926 -16.1 1 1 1 +1Score > 31 indicates identity
Score > 14 indicates homology		 KVGLVFFAIATFVSGFVIAFIR
3962 842.1376 2523.3910 2523.3544 14.5 1 1 0.94 +1Score > 33 indicates identity
Score > 14 indicates homology		 AALADVVLLQADVTADGADDRALLK
4780 870.0334 4345.1306 4345.1324 -0.42 1 1 1 +1Score > 32 indicates identity
Score > 14 indicates homology		 QLTNIPSEPPSNQDVIRPWNNPMYAQGHLAILKGNLATE + 3 Deamidated (NQ); Oxidation (M)
1109 976.5072 975.4999 975.5059 -6.12 1 1 0.98 +1Score > 42 indicates identity
Score > 14 indicates homology		 QLSLEQMK
4332 998.4915 2992.4527 2992.4672 -4.87 1 1 0.89 +1Score > 37 indicates identity
Score > 13 indicates homology		 LLSHLGNVSVQISIDGMDNTHDQLRGR + 2 Deamidated (NQ); Oxidation (M)
4083 898.4231 2692.2475 2692.2724 -9.25 1 1 0.96 +1Score > 37 indicates identity
Score > 14 indicates homology		 ALQQLVADNMAEITAQPAYQMLQE + Deamidated (NQ); Oxidation (M)
4869 995.9186 6964.3793 6964.3199 8.53 1 1 1 +1Score > 27 indicates identity
Score > 14 indicates homology		 MVVIMVIGFLVCWLPYASVAWWIFCNQGSDFGPIFMTLPSFFAKSAAIYNPMIYICMNK + 2 Deamidated (NQ); 3 Oxidation (M)
3474 722.7226 2165.1460 2165.1151 14.3 0 1 0.98 +1Score > 37 indicates identity
Score > 14 indicates homology		 AQAVISAGSTGALMAGATFVLGR + Deamidated (NQ); Oxidation (M)
3601 744.3936 2230.1590 2230.1310 12.6 1 1 0.84 +1Score > 38 indicates identity
Score > 13 indicates homology		 IWNLEITQINPLANFWQK + 3 Deamidated (NQ)
4173 933.8276 2798.4610 2798.4483 4.51 1 1 1 +1Score > 36 indicates identity
Score > 14 indicates homology		 VAQSLLGTMTPSQLARAIADNDAAALAK + 2 Deamidated (NQ)
4854 870.7327 6088.0780 6088.1558 -12.8 1 1 0.84 +1Score > 27 indicates identity
Score > 13 indicates homology		 TAVVNLTQLILGFATMVLAMSLALGFGNSFFVKTAHVVFGAMVAFAIVACVYFSIIE + 3 Deamidated (NQ); Oxidation (M)
4306 986.5337 2956.5793 2956.5546 8.36 1 1 0.88 +1Score > 33 indicates identity
Score > 13 indicates homology		 LVEYGPIQAQVHPGLATLLTGPAGQKPQA + 3 Deamidated (NQ)
4105 903.8193 2708.4361 2708.4346 0.54 1 1 0.89 +1Score > 35 indicates identity
Score > 13 indicates homology		 RLMAYSTILNIGYVLIGVILPNQE + 3 Deamidated (NQ); Oxidation (M)
4828 877.6099 5259.6157 5259.5926 4.41 1 1 1 +1Score > 29 indicates identity
Score > 14 indicates homology		 IIGNFGITGVRPITNVVMMGMGEPLLNLNNVIPAMEIMLDDFAYGLSK + 2 Deamidated (NQ); 5 Oxidation (M)
4686 627.5034 3758.9767 3758.9494 7.26 1 1 1 +1Score > 32 indicates identity
Score > 14 indicates homology		 LGSVGKYIDDHNYPILGICVGAQFIALHFGASVVK + Deamidated (NQ)
756 834.4471 833.4398 833.4429 -3.71 0 1 1 +1Score > 42 indicates identity
Score > 14 indicates homology		 AGMTLAVR + Oxidation (M)
4258 965.4941 2893.4605 2893.4240 12.6 1 1 1 +1Score > 36 indicates identity
Score > 14 indicates homology		 VNDLLGPGVAQAVDGGSVRVSAPMDPSQR + 2 Deamidated (NQ)
4665 921.9781 3683.8833 3683.8928 -2.57 1 1 1 +1Score > 33 indicates identity
Score > 14 indicates homology		 MAPPSITKTATQQDVISTVDIGNSPLLSISLDQSR + Deamidated (NQ)
2984 617.6103 1849.8091 1849.8404 -16.9 1 1 1 +1Score > 37 indicates identity
Score > 14 indicates homology		 NDENSYGILDLLPVCE
3585 741.3716 2221.0930 2221.0777 6.86 1 1 0.89 +1Score > 39 indicates identity
Score > 13 indicates homology		 FGDRSGLNGQGVVGWNGAAFGR
3650 752.4449 2254.3129 2254.2871 11.4 1 1 1 +1Score > 27 indicates identity
Score > 14 indicates homology		 KFSLTKPIIQAPMAGGITKPR + Deamidated (NQ)
139 417.2213 416.2140 416.2132 2.03 0 1 1 +1Score > 39 indicates identity
Score > 14 indicates homology		 AGGGR
4068 669.3229 2673.2625 2673.2248 14.1 1 1 0.88 +1Score > 38 indicates identity
Score > 13 indicates homology		 SSWQWPAIFNWLQQTGNVSRHE + 3 Deamidated (NQ)
4648 726.5668 3627.7976 3627.8164 -5.18 1 1 1 +1Score > 35 indicates identity
Score > 14 indicates homology		 KTINTVVAAMALSTLSFGVFAAEPVTASQAQNMNK + 2 Deamidated (NQ); Oxidation (M)
4181 936.8565 2807.5477 2807.5428 1.73 0 1 1 +1Score > 31 indicates identity
Score > 14 indicates homology		 VIGIAVMLTGISALTLLIGTVSNMFQK + 2 Deamidated (NQ); Oxidation (M)
4325 746.9125 2983.6209 2983.6311 -3.42 1 1 1 +1Score > 32 indicates identity
Score > 14 indicates homology		 LSSNTLVTTVMSNLGLHLAMRSVGVIVR + Oxidation (M)
4716 790.6362 3948.1446 3948.1374 1.83 1 1 1 +1Score > 29 indicates identity
Score > 14 indicates homology		 APGGKYAALAAAAALDQTTTPHPHPVPIAVPPVTVPPAGAR
4684 940.5150 3758.0309 3757.9787 13.9 1 1 1 +1Score > 29 indicates identity
Score > 14 indicates homology		 VTVTGAAGQIGYALLFRVASGQMLGPDQPIILQMLE + Deamidated (NQ)
2970 615.0003 1841.9791 1841.9557 12.7 1 1 0.95 +1Score > 38 indicates identity
Score > 14 indicates homology		 ITVPAQLGGGIRDMATIE + Deamidated (NQ)
4422 628.5183 3137.5551 3137.5341 6.70 0 1 0.77 +1Score > 36 indicates identity
Score > 13 indicates homology		 LNNNGLMLTYGGMSFQPVTIPTSLYIFK + 3 Deamidated (NQ); Oxidation (M)
4299 736.6534 2942.5845 2942.6362 -17.6 0 1 0.78 +1Score > 33 indicates identity
Score > 13 indicates homology		 DIILSNSVVALATAIMASAALVTILVSNR + Deamidated (NQ); Oxidation (M)
3103 966.0299 1930.0452 1930.0623 -8.83 1 1 0.83 +1Score > 37 indicates identity
Score > 13 indicates homology		 VSTDAQLSGLTVVLTGKLE
4349 1007.8856 3020.6350 3020.6640 -9.61 1 1 1 +1Score > 32 indicates identity
Score > 14 indicates homology		 VKIYFPIQLKPSFLAFPHHPLGISNR + 2 Deamidated (NQ)
4072 893.4813 2677.4221 2677.4551 -12.3 1 1 1 +1Score > 35 indicates identity
Score > 14 indicates homology		 QSIVIDPQTAGRWIGDQLLLNLAR + Deamidated (NQ)
4577 840.9635 3359.8249 3359.8064 5.52 0 1 1 +1Score > 31 indicates identity
Score > 14 indicates homology		 LHGSLNMIGYGLAAIGSAIGVGLIFAAYINGVAR + Deamidated (NQ)
4309 988.4865 2962.4377 2962.4027 11.8 1 1 0.86 +1Score > 37 indicates identity
Score > 13 indicates homology		 IITYGKMPYSGMTGAQVIHMLGQNYR + 2 Deamidated (NQ); 2 Oxidation (M)
4466 639.9236 3194.5816 3194.5753 1.96 0 1 0.96 +1Score > 36 indicates identity
Score > 14 indicates homology		 VLQRPVLSSWQALLDYCHTAMAHRPTE + Oxidation (M)
4501 1079.5615 3235.6627 3235.6765 -4.27 1 1 1 +1Score > 35 indicates identity
Score > 14 indicates homology		 AVRASAITDTDGLLTFSAADQPWVFQTLLK + Deamidated (NQ)
2409 520.3170 1557.9292 1557.8991 19.3 1 1 0.8 +1Score > 29 indicates identity
Score > 13 indicates homology		 KFGGQTVVAGNILVR
4423 628.5455 3137.6911 3137.6318 18.9 0 1 1 +1Score > 32 indicates identity
Score > 14 indicates homology		 LDDSDLALFIAAIILCGDRPGLINVPQVE + Deamidated (NQ)
4614 882.4869 3525.9185 3525.8689 14.1 1 1 1 +1Score > 30 indicates identity
Score > 14 indicates homology		 MKPTMLLMITVFLIFPAISQAESPFSSLQSAK
2760 860.4260 1718.8374 1718.8621 -14.3 1 1 0.98 +1Score > 40 indicates identity
Score > 14 indicates homology		 GMKVALDTANGAASVSAR + Deamidated (NQ)
2529 805.9794 1609.9442 1609.9291 9.43 1 1 1 +1Score > 32 indicates identity
Score > 14 indicates homology		 SLVPLEDLQGVLSLK
Page: Previous 1 …23 24 25 26 27 28 29 30 31 32 33 … 38 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/