MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita6 sp
MS data file : PRT1270_T-BRSC_6_20250714122635.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 23:38:56 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,869

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 2601–2700 (out of 3786)

Page: Previous 1 …22 23 24 25 26 27 28 29 30 31 32 … 38 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
4002 645.0958 2576.3541 2576.3890 -13.5 0 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 QYLPFQGQPLILHALNSALLIPE + 2 Deamidated (NQ)
4033 876.7486 2627.2240 2627.2207 1.25 1 2 0.88 +1Score > 37 indicates identity
Score > 14 indicates homology		 MNRTFNNGIGMVVVVDAANAQATAK + 4 Deamidated (NQ); 2 Oxidation (M)
4156 695.3535 2777.3849 2777.4157 -11.1 0 2 0.88 +1Score > 37 indicates identity
Score > 14 indicates homology		 VVVIDSSNATALGAAMLGANVGGAYPTLK + 2 Deamidated (NQ); Oxidation (M)
4384 1023.5609 3067.6609 3067.6459 4.89 1 2 1 +1Score > 32 indicates identity
Score > 15 indicates homology		 AMMGVLGITCGVMVWAGVALLGLHLIIEK + Oxidation (M)
3343 699.3796 2095.1170 2095.1274 -4.95 1 2 0.66 +1Score > 37 indicates identity
Score > 13 indicates homology		 LVAPVGSQDGQSQVLTLVER
3614 746.4243 2236.2511 2236.2150 16.1 1 2 0.67 +1Score > 32 indicates identity
Score > 13 indicates homology		 MFLQARAALVTGGALYIVGNR + Oxidation (M)
4689 945.4972 3777.9597 3777.8892 18.7 1 2 1 +1Score > 32 indicates identity
Score > 15 indicates homology		 MAPNTDIGLIGLAVMGKNLVLNMVDHGFSVSVYNR + Deamidated (NQ); 2 Oxidation (M)
3244 677.0080 2028.0022 2028.0024 -0.13 0 2 0.68 +1Score > 40 indicates identity
Score > 13 indicates homology		 ATGNLPPRPVHPGAAAASSGAE + Deamidated (NQ)
4034 877.0818 2628.2236 2628.2676 -16.8 1 2 0.76 +1Score > 37 indicates identity
Score > 14 indicates homology		 TGQDAFEHLLCGATMLQIGTALHK + Deamidated (NQ); Oxidation (M)
4381 766.6595 3062.6089 3062.5713 12.3 1 2 0.93 +1Score > 34 indicates identity
Score > 15 indicates homology		 IPGGSTQLFVGLHLIHEVTSPQAFSALNE + Deamidated (NQ)
4416 784.3954 3133.5525 3133.6151 -20.0 1 2 0.92 +1Score > 36 indicates identity
Score > 14 indicates homology		 QASFIMPSIIDRSPLMVAISSGGTSPVLAR + Deamidated (NQ); 2 Oxidation (M)
1217 1025.5253 1024.5180 1024.5110 6.81 1 2 0.84 +1Score > 41 indicates identity
Score > 14 indicates homology		 KILSMSTTE + Oxidation (M)
3129 488.0251 1948.0713 1948.0339 19.2 1 2 0.74 +1Score > 35 indicates identity
Score > 14 indicates homology		 TTAQILVRALNPLDYMK + 2 Deamidated (NQ)
3895 616.3372 2461.3197 2461.3113 3.41 0 2 0.83 +1Score > 35 indicates identity
Score > 14 indicates homology		 VSIPVWGMVYIPTAITIMNAIR + Deamidated (NQ); Oxidation (M)
3245 677.0089 2028.0049 2028.0384 -16.5 1 2 0.64 +1Score > 40 indicates identity
Score > 13 indicates homology		 VRIPTPPNTSGVQLICMK + 2 Deamidated (NQ); Oxidation (M)
4540 551.9769 3305.8177 3305.8205 -0.84 0 2 0.68 +1Score > 30 indicates identity
Score > 13 indicates homology		 NLPFLTLGNILVIVGSIIMVVAFLGCMGSIK + Deamidated (NQ); Oxidation (M)
805 853.4621 852.4548 852.4453 11.1 0 2 0.76 +1Score > 39 indicates identity
Score > 14 indicates homology		 QLPQPNR + Deamidated (NQ)
3982 851.1472 2550.4198 2550.4091 4.18 0 2 1 +1Score > 32 indicates identity
Score > 15 indicates homology		 IAQMVIAPVVQAALVPVATLSATDR + Deamidated (NQ); Oxidation (M)
4492 806.6772 3222.6797 3222.6217 18.0 1 2 0.71 +1Score > 34 indicates identity
Score > 13 indicates homology		 QVGVVLQDNVLLNRSIIDNIALADPGMPVE + 5 Deamidated (NQ); Oxidation (M)
3578 738.0320 2211.0742 2211.1099 -16.2 1 2 0.99 +1Score > 39 indicates identity
Score > 15 indicates homology		 HGFPPLNQTLIISPEFASIE + 2 Deamidated (NQ)
3749 777.4097 2329.2073 2329.2095 -0.97 0 2 0.8 +1Score > 37 indicates identity
Score > 14 indicates homology		 LNISIIIMTVVLMIGCGQQPE + Deamidated (NQ)
4462 1064.2731 3189.7975 3189.7550 13.3 1 2 1 +1Score > 28 indicates identity
Score > 15 indicates homology		 FFATGLAYLGAGISILAAGLAGIGQGLAAARAVE
4192 939.1812 2814.5218 2814.5396 -6.34 1 2 0.81 +1Score > 32 indicates identity
Score > 14 indicates homology		 MRTLGAMAIMLVVMGTVIFLSFILR + 2 Oxidation (M)
4621 709.7623 3543.7751 3543.7801 -1.40 0 2 0.87 +1Score > 35 indicates identity
Score > 14 indicates homology		 IMVGNVAVGGDAPISVQTMTNTPTVDAQATIAQIK + Deamidated (NQ); 2 Oxidation (M)
3730 463.6549 2313.2381 2313.2005 16.3 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 AIFNTLEQLVPNAVHVIDYR + 2 Deamidated (NQ)
4611 877.6781 3506.6833 3506.6797 1.04 1 2 0.85 +1Score > 35 indicates identity
Score > 14 indicates homology		 NDSVTSNTPVSGDPMIVLAGPSTMSLNKVFPSNK + 3 Deamidated (NQ)
3477 723.7324 2168.1754 2168.1486 12.3 0 2 0.97 +1Score > 35 indicates identity
Score > 15 indicates homology		 VFLGLALMGVVVQVGSFNMR + 2 Oxidation (M)
4310 988.4923 2962.4551 2962.4845 -9.94 1 2 0.84 +1Score > 37 indicates identity
Score > 14 indicates homology		 GLDLICEVAPQIVAAGGQIAVIGGGEPDIE + 2 Deamidated (NQ)
4339 750.6524 2998.5805 2998.5937 -4.39 0 2 0.99 +1Score > 34 indicates identity
Score > 15 indicates homology		 MLVIFLGILGLLANQVSSQLVGQLHSTE + 3 Deamidated (NQ); Oxidation (M)
191 474.2928 473.2855 473.2850 1.20 0 2 0.69 +1Score > 43 indicates identity
Score > 13 indicates homology		 IVGSV
3155 657.9989 1970.9749 1971.0095 -17.6 1 2 0.79 +1Score > 40 indicates identity
Score > 14 indicates homology		 LSTQLIDMIHTAAARANK + 2 Deamidated (NQ); Oxidation (M)
3331 697.7365 2090.1877 2090.1623 12.1 1 2 1 +1Score > 31 indicates identity
Score > 15 indicates homology		 YIVNTVLDLGGQTTKILDK
3961 842.1042 2523.2908 2523.3082 -6.89 1 2 1 +1Score > 37 indicates identity
Score > 15 indicates homology		 SIITSAISNYNSGVHRFSVVTSGK
4122 911.7938 2732.3596 2732.3956 -13.2 1 2 1 +1Score > 37 indicates identity
Score > 15 indicates homology		 VRVPATSANIGPGFDCLGVAVNIYNK + Deamidated (NQ)
2700 843.9450 1685.8754 1685.8836 -4.82 0 2 1 +1Score > 40 indicates identity
Score > 15 indicates homology		 IQVGANDGQTITIDLK + Deamidated (NQ)
4458 1061.5256 3181.5550 3181.5462 2.76 1 2 0.98 +1Score > 36 indicates identity
Score > 15 indicates homology		 ISNATGLQIHRFQSGPLGGDQQIGAMIANGE + 2 Deamidated (NQ)
3677 760.4019 2278.1839 2278.1416 18.5 1 2 0.94 +1Score > 38 indicates identity
Score > 14 indicates homology		 WGYGATGVVSVASNLVPGLMRE + Oxidation (M)
4220 954.1397 2859.3973 2859.4178 -7.18 1 2 0.69 +1Score > 38 indicates identity
Score > 13 indicates homology		 DVVSYNTLFTAFAANGDGVETLNLLSK + Deamidated (NQ)
4268 967.8482 2900.5228 2900.4927 10.4 1 2 1 +1Score > 35 indicates identity
Score > 15 indicates homology		 VVRNLQAGGHQVLLVGDGVNDAPAMAAAR + 2 Deamidated (NQ)
4308 740.8920 2959.5389 2959.5767 -12.8 1 2 0.82 +1Score > 35 indicates identity
Score > 14 indicates homology		 LPNVLTTPIRPDLVNFVHTNLNKNAR + 4 Deamidated (NQ)
2139 714.4255 1426.8364 1426.8143 15.5 1 2 0.91 +1Score > 34 indicates identity
Score > 14 indicates homology		 AIVSRSAQLLQLE
3569 737.0644 2208.1714 2208.1347 16.6 1 2 0.69 +1Score > 37 indicates identity
Score > 13 indicates homology		 IKSAVQTYLANQPSLMNVTK + 3 Deamidated (NQ)
4488 803.4161 3209.6353 3209.5743 19.0 1 2 0.82 +1Score > 35 indicates identity
Score > 14 indicates homology		 IGNIAMHIHTARNNAGDMTQTLDITTMIR + Deamidated (NQ)
2573 813.8998 1625.7850 1625.8083 -14.3 1 2 0.83 +1Score > 40 indicates identity
Score > 14 indicates homology		 IQPKDLVAVNDPCR + 2 Deamidated (NQ)
4107 903.8201 2708.4385 2708.4064 11.9 1 2 1 +1Score > 35 indicates identity
Score > 15 indicates homology		 QMTLILGTPGCGKSTIFQMLAGQLK + Oxidation (M)
3318 696.0178 2085.0316 2085.0088 10.9 0 2 0.97 +1Score > 39 indicates identity
Score > 14 indicates homology		 QLHDALGAVQMGLIYVNPE + 2 Deamidated (NQ); Oxidation (M)
3514 1093.5974 2185.1802 2185.1378 19.4 1 2 0.95 +1Score > 36 indicates identity
Score > 14 indicates homology		 DANIKSPALAFSLAATAQAAPR + 2 Deamidated (NQ)
4214 951.1443 2850.4111 2850.3900 7.39 1 2 1 +1Score > 37 indicates identity
Score > 15 indicates homology		 MTARMISIYGLVLASMMASVWASSSR + 2 Oxidation (M)
4402 1031.5316 3091.5730 3091.6052 -10.4 1 2 0.94 +1Score > 36 indicates identity
Score > 14 indicates homology		 YAQVKPDGTYVKPLSNKLTYGTMVFVR + Deamidated (NQ); Oxidation (M)
4023 867.1306 2598.3700 2598.3947 -9.53 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 MLSTMQTVGAILMLSIVFVAGTKR + 2 Oxidation (M)
3115 645.6616 1933.9630 1933.9309 16.6 0 2 0.95 +1Score > 40 indicates identity
Score > 14 indicates homology		 NLPINNGSGQPFGLVLYE + 3 Deamidated (NQ)
3595 743.0639 2226.1699 2226.1743 -1.98 1 2 0.68 +1Score > 37 indicates identity
Score > 13 indicates homology		 LDTTKAINLLPANTQINDIR + 3 Deamidated (NQ)
3631 562.0582 2244.2037 2244.2379 -15.2 0 2 0.73 +1Score > 36 indicates identity
Score > 13 indicates homology		 TQRPVLVVDFGAQYAQLIAR
3759 780.7188 2339.1346 2339.1151 8.33 1 2 0.86 +1Score > 39 indicates identity
Score > 14 indicates homology		 VTMNGHVPVGLYGNGFKSGSMR + 2 Oxidation (M)
4215 951.4758 2851.4056 2851.4001 1.92 1 2 1 +1Score > 37 indicates identity
Score > 15 indicates homology		 AQGGQLHHVKPHGALYNQAARDPALAE + 3 Deamidated (NQ)
3793 475.4754 2372.3406 2372.3355 2.15 0 2 0.96 +1Score > 31 indicates identity
Score > 14 indicates homology		 IAAFQALDLDAAVVVAFGQILVK + Deamidated (NQ)
3795 594.0930 2372.3429 2372.3442 -0.56 1 2 0.96 +1Score > 30 indicates identity
Score > 14 indicates homology		 MPAFNRLLPLASLVLIYWVR + Deamidated (NQ)
4143 922.8404 2765.4994 2765.4575 15.2 1 2 0.99 +1Score > 33 indicates identity
Score > 15 indicates homology		 VIIMADADVDGSHIRTLLLTFFFR + Oxidation (M)
4018 863.4473 2587.3201 2587.3633 -16.7 1 2 0.68 +1Score > 37 indicates identity
Score > 13 indicates homology		 SVPINALVAVEGTPLQDLPSIDPIE + Deamidated (NQ)
4191 938.4769 2812.4089 2812.3735 12.6 0 2 0.92 +1Score > 37 indicates identity
Score > 14 indicates homology		 MLQQSQGQPVDMDNASIIATLPADLR + Deamidated (NQ)
4255 724.1178 2892.4421 2892.3865 19.2 1 2 1 +1Score > 37 indicates identity
Score > 15 indicates homology		 VLQAIQYVQAHPDEVCPANWKPGDR + 2 Deamidated (NQ)
4783 876.4655 4377.2911 4377.2105 18.4 1 2 1 +1Score > 29 indicates identity
Score > 15 indicates homology		 SAMIYHLYNNGTPNLMLYILVLSVIDNYGSGIYVWPKK + 2 Deamidated (NQ); Oxidation (M)
3873 813.1090 2436.3052 2436.3475 -17.4 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 ALGTIKNLIYGAVSSSNSSTVLLK + Deamidated (NQ)
3967 846.4343 2536.2811 2536.2665 5.74 0 2 0.89 +1Score > 38 indicates identity
Score > 14 indicates homology		 AMYAPPIGGQISCSSNITGLLLTR + Deamidated (NQ); Oxidation (M)
3925 830.4750 2488.4032 2488.4240 -8.36 1 2 1 +1Score > 30 indicates identity
Score > 15 indicates homology		 MFPLLFVAGLVVLNLVSSARSQK
3928 831.4393 2491.2961 2491.2563 15.9 1 2 1 +1Score > 37 indicates identity
Score > 15 indicates homology		 VFDMGVDVRQLSIADVMTPGGIR + Oxidation (M)
4172 699.8907 2795.5337 2795.5606 -9.62 0 2 1 +1Score > 32 indicates identity
Score > 15 indicates homology		 SIQSGLIEPMVILLILVANATVGVVTE + Deamidated (NQ); Oxidation (M)
3885 816.4265 2446.2577 2446.2236 13.9 0 2 1 +1Score > 37 indicates identity
Score > 15 indicates homology		 VPNAYAALAQLMQLVDSMKPQR + 3 Deamidated (NQ)
3410 710.4152 2128.2238 2128.2078 7.49 1 2 1 +1Score > 29 indicates identity
Score > 14 indicates homology		 LAIAFGIINTPPGTTIRVMK + Oxidation (M)
4378 1021.5302 3061.5688 3061.6012 -10.6 1 2 0.97 +1Score > 36 indicates identity
Score > 14 indicates homology		 SRSGLGLGIGISFFATLVSQLLVYNGVYE + 2 Deamidated (NQ)
3929 832.4196 2494.2370 2494.1910 18.4 1 2 0.97 +1Score > 38 indicates identity
Score > 14 indicates homology		 NMRADLGVVISASHNPFHDNGIK + 3 Deamidated (NQ)
4414 782.6376 3126.5213 3126.5326 -3.61 1 2 0.76 +1Score > 36 indicates identity
Score > 13 indicates homology		 LNQPAQITDSVQVMPLPTQEVQVGTTCR + Deamidated (NQ); Oxidation (M)
3172 661.6731 1981.9975 1981.9680 14.9 1 2 0.97 +1Score > 40 indicates identity
Score > 14 indicates homology		 ACWALDNILVINSAHRE + Deamidated (NQ)
4478 1069.5527 3205.6363 3205.6158 6.38 1 2 1 +1Score > 35 indicates identity
Score > 14 indicates homology		 HFFQKASGFLLLFLSLFMDGLTNATQDK + Deamidated (NQ); Oxidation (M)
3540 1097.5824 2193.1502 2193.1286 9.88 1 2 0.95 +1Score > 37 indicates identity
Score > 14 indicates homology		 MDKKPLNTLISATGLWMSR + 2 Oxidation (M)
4044 879.4173 2635.2301 2635.2224 2.90 1 2 1 +1Score > 37 indicates identity
Score > 14 indicates homology		 GVVNIHLDAVEHGDTIAFMHSVQE + 2 Deamidated (NQ); Oxidation (M)
3645 564.0349 2252.1105 2252.1365 -11.5 1 2 0.95 +1Score > 39 indicates identity
Score > 14 indicates homology		 SLISTYYTYLNRNVPVYGK + 2 Deamidated (NQ)
1212 511.2893 1020.5640 1020.5638 0.29 1 2 0.91 +1Score > 39 indicates identity
Score > 14 indicates homology		 LSKGLGTAMK + Oxidation (M)
2599 409.7283 1634.8841 1634.8628 13.0 1 2 0.92 +1Score > 38 indicates identity
Score > 14 indicates homology		 SLHLDPSDILELGAR
3483 543.8005 2171.1729 2171.1474 11.7 1 2 0.98 +1Score > 36 indicates identity
Score > 14 indicates homology		 TPKGFGILDGVVPVTTIQNSE
3620 747.0492 2238.1258 2238.1352 -4.22 0 2 0.98 +1Score > 39 indicates identity
Score > 14 indicates homology		 ISNQLQNPNKPNIVNSSQSR + Deamidated (NQ)
4074 893.8149 2678.4229 2678.4214 0.55 1 2 0.95 +1Score > 35 indicates identity
Score > 14 indicates homology		 VLNQTMPQVAAKLGATVTIWHQSGK + Deamidated (NQ)
2512 802.9554 1603.8962 1603.8682 17.5 1 2 0.67 +1Score > 36 indicates identity
Score > 13 indicates homology		 ALAGKFNGQLIDTTR
4412 1041.5718 3121.6936 3121.6580 11.4 1 2 1 +1Score > 32 indicates identity
Score > 14 indicates homology		 NAITVIIALGGSTNAVLHLIAMANAAEVNLK + 4 Deamidated (NQ); Oxidation (M)
2426 392.4604 1565.8125 1565.7858 17.0 0 2 0.9 +1Score > 40 indicates identity
Score > 14 indicates homology		 ITTIMTTDLITAQE + Oxidation (M)
3910 825.4119 2473.2139 2473.2489 -14.2 1 2 0.79 +1Score > 38 indicates identity
Score > 13 indicates homology		 WPLAQAFVVISAVQAAAEQAGATSS + Deamidated (NQ)
4161 928.4929 2782.4569 2782.4516 1.88 1 2 0.69 +1Score > 36 indicates identity
Score > 13 indicates homology		 TVRPMFFQFIEPSKQYADIIVPR + Deamidated (NQ)
3649 752.3861 2254.1365 2254.1667 -13.4 1 2 1 +1Score > 39 indicates identity
Score > 14 indicates homology		 IQGNDLYMIGIYDIGGRIVK + Deamidated (NQ); Oxidation (M)
1103 973.5175 972.5102 972.5240 -14.2 0 2 0.92 +1Score > 43 indicates identity
Score > 14 indicates homology		 AGVDLITQR + Deamidated (NQ)
4224 716.8561 2863.3953 2863.3505 15.6 0 2 1 +1Score > 37 indicates identity
Score > 14 indicates homology		 GIINQTNNPTMDTSAITQATTQVNNAK + 2 Deamidated (NQ); Oxidation (M)
4589 680.9681 3399.8041 3399.8040 0.026 1 2 1 +1Score > 32 indicates identity
Score > 14 indicates homology		 GARAVVVGASNIVGKPMAMLLLQGGATVTICNSK + Deamidated (NQ); Oxidation (M)
3224 672.0016 2012.9830 2013.0088 -12.9 1 2 1 +1Score > 40 indicates identity
Score > 14 indicates homology		 VKLSSDTCYSTTQKPIGK + Deamidated (NQ)
3576 737.6971 2210.0695 2210.0392 13.7 1 2 0.99 +1Score > 39 indicates identity
Score > 14 indicates homology		 NQPQSVAPFLNGAGFTEGGYR + Deamidated (NQ)
4350 756.3890 3021.5269 3021.5739 -15.6 1 2 1 +1Score > 36 indicates identity
Score > 14 indicates homology		 SNIVGKPIANMMLQKGPGANATVTVVHTR + 2 Deamidated (NQ); Oxidation (M)
4521 652.9680 3259.8036 3259.7939 3.00 1 2 0.68 +1Score > 29 indicates identity
Score > 13 indicates homology		 MLMILLFQRLGIIMILAFLLVNNSYFR + 2 Deamidated (NQ); Oxidation (M)
4522 817.4159 3265.6345 3265.6443 -3.00 1 2 1 +1Score > 36 indicates identity
Score > 14 indicates homology		 LQLKKPYLCIMFAFLTSEPGAYDGVLYE
3444 717.3533 2149.0381 2149.0539 -7.35 0 2 0.94 +1Score > 40 indicates identity
Score > 14 indicates homology		 NVGSTALSPYPTAISGLQSQR + 3 Deamidated (NQ)
4316 990.5212 2968.5418 2968.5885 -15.7 1 2 1 +1Score > 35 indicates identity
Score > 14 indicates homology		 TLNVPGAVLVFLPGWNLIYTMQKHLE + Oxidation (M)
2730 569.3159 1704.9259 1704.9046 12.5 1 2 0.8 +1Score > 37 indicates identity
Score > 13 indicates homology		 AEAHPVQIQTQLLQK + 2 Deamidated (NQ)
4448 795.4156 3177.6333 3177.6104 7.22 1 2 1 +1Score > 35 indicates identity
Score > 14 indicates homology		 HPMTDLDRQMIDWFAPSGKPIHVLLTK + 2 Oxidation (M)
Page: Previous 1 …22 23 24 25 26 27 28 29 30 31 32 … 38 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/