MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita6 sp
MS data file : PRT1270_T-BRSC_6_20250714122635.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 23:38:56 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,869

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 2001–2100 (out of 3786)

Page: Previous 1 …16 17 18 19 20 21 22 23 24 25 26 … 38 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3322 696.0277 2085.0613 2085.0854 -11.6 1 6 0.72 +1Score > 39 indicates identity
Score > 17 indicates homology		 AQPGGLAALQAALADATVEYR
1796 425.5519 1273.6339 1273.6514 -13.7 1 6 0.77 +1Score > 41 indicates identity
Score > 18 indicates homology		 TLTNLNQELAR + 2 Deamidated (NQ)
3451 1076.5642 2151.1138 2151.1463 -15.1 0 6 0.68 +1Score > 38 indicates identity
Score > 17 indicates homology		 ALLNFITAAQNYIQNTLLK + 3 Deamidated (NQ)
3818 797.4131 2389.2175 2389.2172 0.12 1 6 0.32 +1Score > 38 indicates identity
Score > 14 indicates homology		 RDNMQLQVVNYIISGNGKPSR + Deamidated (NQ)
2934 453.9880 1811.9229 1811.8975 14.0 0 6 0.86 +1Score > 40 indicates identity
Score > 18 indicates homology		 GSVTNMLTSIVGNVFGAK + 2 Deamidated (NQ); Oxidation (M)
2995 928.4939 1854.9732 1854.9873 -7.59 0 6 0.58 +1Score > 39 indicates identity
Score > 16 indicates homology		 LQQVHTGIMLSTQLLR + 2 Deamidated (NQ); Oxidation (M)
3060 947.4986 1892.9826 1892.9956 -6.83 0 6 0.82 +1Score > 39 indicates identity
Score > 18 indicates homology		 IDQASNVLQTVQHQLAK + Deamidated (NQ)
3508 728.0598 2181.1576 2181.1641 -2.98 1 6 0.72 +1Score > 37 indicates identity
Score > 17 indicates homology		 ATTPLTAATSNPSTPAKPAKQK + Deamidated (NQ)
3848 806.0904 2415.2494 2415.2467 1.09 1 6 0.45 +1Score > 37 indicates identity
Score > 15 indicates homology		 AQLLTNNMLPNGIFSLQIPRR + 4 Deamidated (NQ); Oxidation (M)
4395 772.3746 3085.4693 3085.4589 3.36 1 6 0.95 +1Score > 37 indicates identity
Score > 18 indicates homology		 LATPLHYAAANNYKDLTQYLLNMNANK + 5 Deamidated (NQ); Oxidation (M)
1801 638.8611 1275.7076 1275.7009 5.28 1 6 0.32 +1Score > 39 indicates identity
Score > 14 indicates homology		 LMSKILGSFHK + Oxidation (M)
3102 644.0266 1929.0580 1929.0572 0.42 1 6 0.61 +1Score > 36 indicates identity
Score > 17 indicates homology		 VTVVLDGAELTFAVSVPGR
3186 663.6837 1988.0293 1988.0500 -10.4 1 6 0.91 +1Score > 39 indicates identity
Score > 18 indicates homology		 VQGVTITEVQMLGDLSVAK + Deamidated (NQ)
4089 898.4575 2692.3507 2692.2989 19.2 1 6 0.52 +1Score > 37 indicates identity
Score > 16 indicates homology		 WMGQVHRFLGLSVGLIQSSMTPSE + Deamidated (NQ); 2 Oxidation (M)
4519 652.7530 3258.7286 3258.6788 15.3 0 6 0.46 +1Score > 33 indicates identity
Score > 15 indicates homology		 QLVVWPTLQSMLYEPDLIVAVGNGWWTK + Oxidation (M)
2128 474.6090 1420.8052 1420.7787 18.7 1 6 0.93 +1Score > 35 indicates identity
Score > 18 indicates homology		 APNLTGQHKVTVR + Deamidated (NQ)
2328 758.4536 1514.8926 1514.8668 17.1 1 6 0.7 +1Score > 32 indicates identity
Score > 17 indicates homology		 LSPGVTLNIKTSTGK
3591 1112.0242 2222.0338 2222.0678 -15.3 1 6 0.99 +1Score > 39 indicates identity
Score > 19 indicates homology		 QILPLFDQFTQDIAAECGR + Deamidated (NQ)
2821 439.5107 1754.0137 1754.0163 -1.47 1 6 0.33 +1Score > 32 indicates identity
Score > 14 indicates homology		 VTINARTGTIVINGAVR
3260 680.3697 2038.0873 2038.0768 5.12 0 6 0.91 +1Score > 37 indicates identity
Score > 18 indicates homology		 GTLPLNVIQMSQQKPLPR + 3 Deamidated (NQ); Oxidation (M)
2117 708.4023 1414.7900 1414.7933 -2.28 1 6 0.97 +1Score > 38 indicates identity
Score > 18 indicates homology		 IVVTRDPDVVFR
2793 578.2627 1731.7663 1731.7753 -5.23 1 6 0.65 +1Score > 39 indicates identity
Score > 17 indicates homology		 YNDAVNRWHWQNK + 2 Deamidated (NQ)
3920 828.0806 2481.2200 2481.1958 9.73 0 6 1 +1Score > 38 indicates identity
Score > 19 indicates homology		 AVQNSNTQVLIATPGCFAGPHIGE + Deamidated (NQ)
266 579.3005 578.2932 578.2846 14.9 0 6 0.37 +1Score > 38 indicates identity
Score > 14 indicates homology		 ASVMR + Oxidation (M)
511 708.3705 707.3632 707.3602 4.26 0 6 0.61 +1Score > 41 indicates identity
Score > 16 indicates homology		 DAYAIR
3823 799.4206 2395.2400 2395.2608 -8.68 1 6 0.5 +1Score > 37 indicates identity
Score > 16 indicates homology		 APNRYLGGAIAIGPQTAADALAQR + Deamidated (NQ)
4675 927.4695 3705.8489 3705.8638 -4.02 1 6 1 +1Score > 34 indicates identity
Score > 19 indicates homology		 SIGLAQAAHSPLAPSYQASPHINAQDSLLQRSVFK + 4 Deamidated (NQ)
227 517.3007 516.2934 516.3020 -16.6 0 6 0.64 +1Score > 48 indicates identity
Score > 17 indicates homology		 IAASR
1847 647.9130 1293.8114 1293.8060 4.20 1 6 0.79 +1Score > 27 indicates identity
Score > 17 indicates homology		 KSLLYGFIILK
2187 729.9172 1457.8198 1457.8064 9.20 0 6 0.97 +1Score > 37 indicates identity
Score > 18 indicates homology		 TLLMIQDGLWIR
3876 813.7891 2438.3455 2438.3281 7.12 1 6 0.81 +1Score > 32 indicates identity
Score > 18 indicates homology		 LIEGYLNNRPNLAGIVQIVDAR + Deamidated (NQ)
449 684.3214 683.3141 683.3061 11.7 0 6 0.54 +1Score > 37 indicates identity
Score > 16 indicates homology		 TGFGMR + Oxidation (M)
2296 753.9325 1505.8504 1505.8314 12.6 1 6 0.91 +1Score > 35 indicates identity
Score > 18 indicates homology		 LLEPSLGKSGVNHR
2631 826.4312 1650.8478 1650.8287 11.6 1 6 0.97 +1Score > 40 indicates identity
Score > 18 indicates homology		 FLLDSVAEVGMNAIR + Deamidated (NQ); Oxidation (M)
4183 702.8945 2807.5489 2807.5605 -4.14 1 6 0.4 +1Score > 31 indicates identity
Score > 14 indicates homology		 LSNLQAMLPILEAVVQTSKPLVIISE + 2 Deamidated (NQ)
3617 746.7272 2237.1598 2237.1587 0.50 1 6 0.29 +1Score > 38 indicates identity
Score > 13 indicates homology		 GLTPSQIGVMLRDSHGVAQVR + Deamidated (NQ); Oxidation (M)
3954 631.1004 2520.3725 2520.4163 -17.4 1 6 0.86 +1Score > 34 indicates identity
Score > 18 indicates homology		 VLGLPSQSAALLTTLLLRGPQTAAE + Deamidated (NQ)
3756 585.0393 2336.1281 2336.1179 4.36 1 6 0.29 +1Score > 39 indicates identity
Score > 13 indicates homology		 NASKGPHSPQVPSQVQSPMTSR + Deamidated (NQ); Oxidation (M)
835 864.4450 863.4377 863.4283 10.9 1 6 0.42 +1Score > 42 indicates identity
Score > 15 indicates homology		 AMSRLDR + Oxidation (M)
1948 671.9150 1341.8154 1341.8232 -5.74 1 6 0.94 +1Score > 30 indicates identity
Score > 18 indicates homology		 LSLKQTDVVIVK
4243 720.1630 2876.6229 2876.5719 17.7 1 6 0.38 +1Score > 29 indicates identity
Score > 14 indicates homology		 GNITIQIQGNGPLKLLLVNGSDSQQIR + Deamidated (NQ)
2441 524.6436 1570.9090 1570.8831 16.5 0 6 0.57 +1Score > 33 indicates identity
Score > 16 indicates homology		 NLLAGGLGIDNLFVR
3758 1170.5743 2339.1340 2339.0991 14.9 1 6 0.52 +1Score > 39 indicates identity
Score > 16 indicates homology		 YPLSFVNCVNSIGNGLVIEDE + Deamidated (NQ)
4371 1018.5490 3052.6252 3052.6040 6.93 1 6 0.97 +1Score > 33 indicates identity
Score > 18 indicates homology		 TIDDLKNQILNLTTDNANILLQIDNAR + Deamidated (NQ)
3078 638.6463 1912.9171 1912.9023 7.72 0 6 0.79 +1Score > 40 indicates identity
Score > 17 indicates homology		 GIDALVVIGGDGSYMGAMR + 2 Oxidation (M)
3507 546.2851 2181.1113 2181.1318 -9.39 1 6 0.76 +1Score > 39 indicates identity
Score > 17 indicates homology		 GITSIQVDTKLQGFSFNVVE
3357 1056.0502 2110.0858 2110.1133 -13.0 1 6 0.66 +1Score > 38 indicates identity
Score > 17 indicates homology		 AGECPYQVSLPPLTIQLPK
2146 715.8729 1429.7312 1429.7136 12.3 0 6 0.64 +1Score > 41 indicates identity
Score > 16 indicates homology		 HNIGFMALDAVAR + Oxidation (M)
2701 563.3008 1686.8806 1686.9053 -14.7 0 6 0.91 +1Score > 40 indicates identity
Score > 18 indicates homology		 SIGNSSSLQILYLHR
2534 538.2938 1611.8596 1611.8522 4.60 1 6 0.9 +1Score > 39 indicates identity
Score > 18 indicates homology		 WAVQVLQVAEQWR
3256 1019.5294 2037.0442 2037.0280 8.00 1 6 0.71 +1Score > 39 indicates identity
Score > 17 indicates homology		 NWNVEDGHITDVLLGSLR
1560 591.3677 1180.7208 1180.7067 12.0 1 6 0.94 +1Score > 31 indicates identity
Score > 18 indicates homology		 DVVPVGILLKE
3068 635.0303 1902.0691 1902.0436 13.4 1 6 0.4 +1Score > 34 indicates identity
Score > 14 indicates homology		 DQRILQAGVHVVVGTPGR + Deamidated (NQ)
3390 1061.0498 2120.0850 2120.1114 -12.4 1 6 0.76 +1Score > 39 indicates identity
Score > 17 indicates homology		 VLRDAVGGSGLPADAVQLVPGE + Deamidated (NQ)
2304 378.7177 1510.8417 1510.8541 -8.22 0 6 0.99 +1Score > 37 indicates identity
Score > 18 indicates homology		 MAAAADLVVPTLAIR
3117 646.3480 1936.0222 1936.0346 -6.42 1 6 0.63 +1Score > 38 indicates identity
Score > 16 indicates homology		 DILKIGNWVFTGIFIAE + Deamidated (NQ)
3128 972.5266 1943.0386 1943.0186 10.3 0 6 0.31 +1Score > 38 indicates identity
Score > 13 indicates homology		 VFNMNKPGALLNIVVGGAE + Deamidated (NQ)
3780 787.4304 2359.2694 2359.2787 -3.95 1 6 0.3 +1Score > 35 indicates identity
Score > 13 indicates homology		 LLPPALYSRLAGEPGAAEPLPVE
4543 662.3724 3306.8256 3306.8380 -3.74 1 6 0.96 +1Score > 30 indicates identity
Score > 18 indicates homology		 NFLLLLLAAYALGSTPFAIVSSRLFGLADPR + Deamidated (NQ)
1882 657.2755 1312.5364 1312.5493 -9.77 0 6 0.91 +1Score > 37 indicates identity
Score > 18 indicates homology		 ANMYTLQIDDE + Deamidated (NQ)
3520 438.4180 2187.0536 2187.0598 -2.85 1 6 0.7 +1Score > 39 indicates identity
Score > 17 indicates homology		 DMKGDMAGAAAVVGLMHALAAR + 2 Oxidation (M)
3861 484.6606 2418.2666 2418.2583 3.42 1 6 0.8 +1Score > 37 indicates identity
Score > 17 indicates homology		 NNIEYDFITLHVGLGTFLPVR + Deamidated (NQ)
4263 724.8969 2895.5585 2895.5779 -6.72 0 6 0.43 +1Score > 33 indicates identity
Score > 15 indicates homology		 LANLNADIMVVVAYGLLLPQAVLDTPR + Deamidated (NQ); Oxidation (M)
3086 479.7760 1915.0749 1915.0891 -7.41 1 6 1 +1Score > 34 indicates identity
Score > 18 indicates homology		 YLGKGVLTAVANVNDLIR
3694 766.0504 2295.1294 2295.1165 5.61 1 6 0.83 +1Score > 39 indicates identity
Score > 18 indicates homology		 ASLDQGRGYLATIMVQDGNLR + 2 Deamidated (NQ); Oxidation (M)
3896 822.1144 2463.3214 2463.3009 8.31 0 6 0.58 +1Score > 35 indicates identity
Score > 16 indicates homology		 IAVAHYAAQLSTLDINPQPLSLE
2676 836.4681 1670.9216 1670.8960 15.4 1 6 0.49 +1Score > 37 indicates identity
Score > 15 indicates homology		 LRAIGIQPDMIICR + Oxidation (M)
3229 673.7222 2018.1448 2018.1459 -0.55 1 6 0.63 +1Score > 32 indicates identity
Score > 16 indicates homology		 DLLVRLDLIAMAPGRPPR + Oxidation (M)
3785 788.7225 2363.1457 2363.1573 -4.92 1 6 0.77 +1Score > 39 indicates identity
Score > 17 indicates homology		 QLRQDMTSLMTAAIDAGDAAIR + Oxidation (M)
4035 877.4673 2629.3801 2629.3679 4.62 1 6 0.74 +1Score > 36 indicates identity
Score > 17 indicates homology		 NYLTEFFISINLQLWVTATDLK + Deamidated (NQ)
1567 593.3261 1184.6376 1184.6401 -2.06 0 6 0.76 +1Score > 40 indicates identity
Score > 17 indicates homology		 SQILGLTNGPGK + Deamidated (NQ)
3057 631.3558 1891.0456 1891.0203 13.3 1 6 0.36 +1Score > 35 indicates identity
Score > 14 indicates homology		 RLSTYVGNLNVVLFAPE
3191 664.3516 1990.0330 1989.9942 19.5 1 6 0.57 +1Score > 39 indicates identity
Score > 16 indicates homology		 GNVYAQLSPILRDLDCR + Deamidated (NQ)
3495 1090.0332 2178.0518 2178.0853 -15.4 0 6 0.55 +1Score > 40 indicates identity
Score > 16 indicates homology		 LMLASMFHSLFAIGSQLSPE
3994 856.4630 2566.3672 2566.3326 13.5 1 6 0.71 +1Score > 35 indicates identity
Score > 17 indicates homology		 ISLMRNHSNIQSVSNVPYHLLK + Deamidated (NQ); Oxidation (M)
2621 824.4446 1646.8746 1646.8701 2.73 1 6 0.75 +1Score > 39 indicates identity
Score > 17 indicates homology		 VLINPYAVKNQMLE + Oxidation (M)
3557 1102.5300 2203.0454 2203.0806 -15.9 1 6 0.29 +1Score > 39 indicates identity
Score > 13 indicates homology		 RVLWLCLMQTYFTASVSE
3723 1155.6556 2309.2966 2309.2718 10.8 1 6 0.97 +1Score > 31 indicates identity
Score > 18 indicates homology		 QKHPNIPIGLLMYANLVFNK
3043 471.7326 1882.9013 1882.9101 -4.68 0 6 0.55 +1Score > 40 indicates identity
Score > 16 indicates homology		 TAYPGDIIGFHSYNSIK + Deamidated (NQ)
3639 751.3672 2251.0798 2251.1120 -14.3 0 6 0.38 +1Score > 39 indicates identity
Score > 14 indicates homology		 WSYGLNLGGIGVTGNSAANSIAK + 2 Deamidated (NQ)
2794 578.2629 1731.7669 1731.7799 -7.53 1 6 0.5 +1Score > 39 indicates identity
Score > 15 indicates homology		 ADTTTGSAAGPPLSEDDK
3528 730.3848 2188.1326 2188.1483 -7.18 1 6 0.99 +1Score > 38 indicates identity
Score > 18 indicates homology		 NLSITNGLIVSEAVMMALAPK + Deamidated (NQ); Oxidation (M)
3194 999.4933 1996.9720 1996.9850 -6.46 1 6 0.51 +1Score > 40 indicates identity
Score > 15 indicates homology		 LTLITPAMSVGSKLDCFE + Oxidation (M)
3581 555.0688 2216.2461 2216.2466 -0.21 0 6 0.53 +1Score > 32 indicates identity
Score > 15 indicates homology		 VMAVGPYVVVGLVIWVCVLK + Oxidation (M)
4248 961.8220 2882.4442 2882.4082 12.5 0 6 0.31 +1Score > 37 indicates identity
Score > 13 indicates homology		 SLNVTLNLSMDNSFVIDTPLMWLNK + 2 Deamidated (NQ); Oxidation (M)
2440 524.6435 1570.9087 1570.8943 9.13 1 6 0.78 +1Score > 33 indicates identity
Score > 17 indicates homology		 QVGKAPAANLPHVLR + Deamidated (NQ)
3126 648.3514 1942.0324 1942.0445 -6.23 1 6 0.7 +1Score > 38 indicates identity
Score > 17 indicates homology		 LNIVLELADAGDLSQMIK
2521 804.5002 1606.9858 1606.9657 12.5 1 6 1 +1Score > 25 indicates identity
Score > 18 indicates homology		 IQLIKNIIQPALNK + 2 Deamidated (NQ)
3441 716.3817 2146.1233 2146.0959 12.7 0 6 0.46 +1Score > 38 indicates identity
Score > 15 indicates homology		 AHHASLWSAGYPNLALVDPK
3205 1004.5870 2007.1594 2007.1405 9.46 1 6 0.45 +1Score > 29 indicates identity
Score > 15 indicates homology		 IVLGIDPALGSLGWAVVAKE
2347 765.4301 1528.8456 1528.8171 18.7 1 6 1 +1Score > 38 indicates identity
Score > 18 indicates homology		 AAMVIEGQVILAGIE + Oxidation (M)
2612 822.4230 1642.8314 1642.8348 -2.06 1 6 0.61 +1Score > 40 indicates identity
Score > 16 indicates homology		 DRLIPSEPMVTQTR + Deamidated (NQ)
2975 615.9754 1844.9044 1844.9277 -12.6 1 6 0.84 +1Score > 40 indicates identity
Score > 17 indicates homology		 RMAYAEPAALHMLLDK + Oxidation (M)
3995 856.4739 2566.3999 2566.3837 6.30 1 6 0.41 +1Score > 33 indicates identity
Score > 14 indicates homology		 MNKPFLILLIALIAFSGCNMRK + Deamidated (NQ); Oxidation (M)
4546 662.5690 3307.8086 3307.7964 3.69 1 6 0.44 +1Score > 30 indicates identity
Score > 15 indicates homology		 VLYILLLVVGFSLMCLELFHSSNVIDGLK + Oxidation (M)
2467 790.9660 1579.9174 1579.8861 19.8 0 6 0.81 +1Score > 33 indicates identity
Score > 17 indicates homology		 LATLTQITPFFLSK + Deamidated (NQ)
1961 450.2755 1347.8047 1347.8126 -5.86 1 6 0.93 +1Score > 30 indicates identity
Score > 18 indicates homology		 ISVLKLFSVAGSK
1921 663.4162 1324.8178 1324.8442 -19.9 1 6 0.92 +1Score > 29 indicates identity
Score > 18 indicates homology		 VVKNTLLNLALK
3345 700.0084 2097.0034 2097.0387 -16.8 0 6 1 +1Score > 39 indicates identity
Score > 18 indicates homology		 NFDFRPGMIIINLDLMR + Deamidated (NQ); 2 Oxidation (M)
2443 524.9470 1571.8192 1571.7991 12.8 1 6 0.53 +1Score > 40 indicates identity
Score > 15 indicates homology		 RFSHVMHLSSTVR + Oxidation (M)
Page: Previous 1 …16 17 18 19 20 21 22 23 24 25 26 … 38 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/