MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | Rita6 sp |
| MS data file | : | PRT1270_T-BRSC_6_20250714122635.mgf |
| Database | : | SwissProt 57.15 (515,203 sequences; 181,334,896 residues) |
| Timestamp | : | 12 Aug 2025 at 23:38:56 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | GluC_Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,869 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 2184 |
728.4339 | 1454.8532 | 1454.8609 | -5.28 | 1 | 9 | 0.63 | 1Score > 34 indicates identity Score > 19 indicates homology |
SVIGQAVVRVLWK + Deamidated (NQ) |
| 1187 |
506.7424 | 1011.4702 | 1011.4695 | 0.71 | 1 | 9 | 0.72 | 1Score > 40 indicates identity Score > 20 indicates homology |
KSGAVAMFGE + Oxidation (M) |
| 1571 |
593.3483 | 1184.6820 | 1184.6951 | -11.0 | 1 | 9 | 0.98 | 1Score > 39 indicates identity Score > 21 indicates homology |
VVKLCPTGAIK |
| 3123 |
648.0293 | 1941.0661 | 1941.0836 | -9.02 | 0 | 9 | 0.4 | 1Score > 36 indicates identity Score > 17 indicates homology |
AIILVSLPFNASWLNQR |
| 730 |
411.2434 | 820.4722 | 820.4629 | 11.4 | 0 | 9 | 0.25 | 1Score > 37 indicates identity Score > 15 indicates homology |
LFALMAR |
| 2107 |
706.4291 | 1410.8436 | 1410.8195 | 17.1 | 0 | 9 | 0.75 | 1Score > 33 indicates identity Score > 20 indicates homology |
LTQIAGQKPVVTR + Deamidated (NQ) |
| 3093 |
641.3531 | 1921.0375 | 1921.0057 | 16.5 | 0 | 9 | 0.31 | 1Score > 36 indicates identity Score > 16 indicates homology |
ALQLRPDQYVISFQSR + Deamidated (NQ) |
| 3561 |
735.3813 | 2203.1221 | 2203.1056 | 7.49 | 0 | 9 | 0.23 | 1Score > 38 indicates identity Score > 15 indicates homology |
MIDTDGFRPNVGIILADGSGR |
| 2136 |
712.8672 | 1423.7198 | 1423.7194 | 0.29 | 1 | 9 | 0.75 | 1Score > 40 indicates identity Score > 20 indicates homology |
DLQKNPQIQPLE + 2 Deamidated (NQ) |
| 3211 |
670.9863 | 2009.9371 | 2009.9252 | 5.91 | 0 | 9 | 0.89 | 1Score > 39 indicates identity Score > 21 indicates homology |
FAGDDLPSTDISASVAMADK |
| 3521 |
547.7711 | 2187.0553 | 2187.0365 | 8.58 | 1 | 9 | 0.8 | 1Score > 39 indicates identity Score > 20 indicates homology |
GDVMDKTNGLPVQNGIDADVK + 2 Deamidated (NQ) |
| 4159 |
696.0977 | 2780.3617 | 2780.3756 | -4.99 | 1 | 9 | 0.26 | 1Score > 38 indicates identity Score > 16 indicates homology |
NRPDYVNIQLYLSQTDGIQKIIGE + 4 Deamidated (NQ) |
| 2906 |
901.5016 | 1800.9886 | 1800.9808 | 4.37 | 1 | 9 | 0.2 | 1Score > 36 indicates identity Score > 14 indicates homology |
DPALMIRTAPDIFTLK |
| 3344 |
525.2570 | 2096.9989 | 2096.9724 | 12.6 | 1 | 9 | 0.35 | 1Score > 39 indicates identity Score > 17 indicates homology |
AEALIMTFSLNNYPAGDPR + 2 Deamidated (NQ); Oxidation (M) |
| 1722 |
413.8954 | 1238.6644 | 1238.6407 | 19.1 | 1 | 9 | 0.77 | 1Score > 39 indicates identity Score > 20 indicates homology |
NNQKIFANYK |
| 1788 |
424.5556 | 1270.6450 | 1270.6703 | -19.9 | 1 | 9 | 0.83 | 1Score > 40 indicates identity Score > 21 indicates homology |
LLNPMAEALQR + Oxidation (M) |
| 1034 |
475.2555 | 948.4964 | 948.5128 | -17.2 | 0 | 9 | 0.44 | 1Score > 41 indicates identity Score > 18 indicates homology |
SISSLLDSK |
| 2654 |
834.4547 | 1666.8948 | 1666.9115 | -9.96 | 1 | 9 | 0.54 | 1Score > 38 indicates identity Score > 19 indicates homology |
HRIDAVIATNTTISR |
| 3485 |
1087.0436 | 2172.0726 | 2172.0806 | -3.66 | 1 | 9 | 0.41 | 1Score > 39 indicates identity Score > 17 indicates homology |
IPLLPENNMSASIDCAGILK + Deamidated (NQ); Oxidation (M) |
| 321 |
308.2132 | 614.4118 | 614.4115 | 0.52 | 1 | 9 | 1 | 1Score > 41 indicates identity Score > 21 indicates homology |
KIGVAK |
| 1997 |
683.3260 | 1364.6374 | 1364.6554 | -13.1 | 0 | 9 | 0.75 | 1Score > 41 indicates identity Score > 20 indicates homology |
YWLYPYGTFR |
| 2243 |
741.9474 | 1481.8802 | 1481.8540 | 17.7 | 1 | 9 | 0.24 | 1Score > 32 indicates identity Score > 15 indicates homology |
MLFPSIIAGLKHR |
| 2154 |
718.3781 | 1434.7416 | 1434.7354 | 4.34 | 1 | 9 | 0.58 | 1Score > 41 indicates identity Score > 19 indicates homology |
LQNQVLDSKNFK + 2 Deamidated (NQ) |
| 3948 |
837.4686 | 2509.3840 | 2509.3462 | 15.1 | 1 | 9 | 0.25 | 1Score > 32 indicates identity Score > 15 indicates homology |
VAEMLAPVLTGNDLILVQGAGNIGK + Deamidated (NQ); Oxidation (M) |
| 2373 |
515.2861 | 1542.8365 | 1542.8114 | 16.2 | 1 | 9 | 0.89 | 1Score > 39 indicates identity Score > 21 indicates homology |
DRSGVLAAAGTVNGVR + Deamidated (NQ) |
| 3008 |
932.9975 | 1863.9804 | 1863.9843 | -2.07 | 1 | 9 | 0.91 | 1Score > 38 indicates identity Score > 21 indicates homology |
LDALFDQAVNFVTQKR |
| 3170 |
991.4902 | 1980.9658 | 1980.9615 | 2.19 | 1 | 9 | 0.64 | 1Score > 40 indicates identity Score > 19 indicates homology |
GVSAFPPEVTVQMVANYR + Deamidated (NQ); Oxidation (M) |
| 4106 |
903.8199 | 2708.4379 | 2708.4445 | -2.46 | 1 | 9 | 0.31 | 1Score > 35 indicates identity Score > 16 indicates homology |
NLNTVSFTVLLLVLLMASTGILETE + 2 Deamidated (NQ); Oxidation (M) |
| 3424 |
712.7115 | 2135.1127 | 2135.0833 | 13.7 | 1 | 9 | 0.41 | 1Score > 38 indicates identity Score > 17 indicates homology |
LVHHDIIDALENMSRPFK + Deamidated (NQ) |
| 1435 |
378.1975 | 1131.5707 | 1131.5594 | 9.97 | 0 | 9 | 0.96 | 1Score > 42 indicates identity Score > 21 indicates homology |
QVLNLCQQK + 2 Deamidated (NQ) |
| 1688 |
410.5819 | 1228.7239 | 1228.7390 | -12.3 | 1 | 9 | 0.91 | 1Score > 36 indicates identity Score > 21 indicates homology |
KITLNIQIASK + Deamidated (NQ) |
| 3178 |
663.3179 | 1986.9319 | 1986.9534 | -10.8 | 1 | 9 | 0.7 | 1Score > 39 indicates identity Score > 20 indicates homology |
FSHINQPVKTLSGGNQQK + 5 Deamidated (NQ) |
| 3461 |
1078.0334 | 2154.0522 | 2154.0892 | -17.1 | 1 | 9 | 0.69 | 1Score > 39 indicates identity Score > 20 indicates homology |
VQVAATVAACAGVRIAYAHPE + Deamidated (NQ) |
| 4711 |
976.9781 | 3903.8833 | 3903.8089 | 19.1 | 0 | 9 | 1 | 1Score > 34 indicates identity Score > 21 indicates homology |
QQAQRPQQAPQRPAPQQPAPQPAADFDSFDDDIPF + 2 Deamidated (NQ) |
| 2677 |
836.9454 | 1671.8762 | 1671.8792 | -1.74 | 1 | 9 | 0.22 | 1Score > 40 indicates identity Score > 15 indicates homology |
NRAQVVIDTTTLSPR + 2 Deamidated (NQ) |
| 1993 |
682.3423 | 1362.6700 | 1362.6667 | 2.46 | 0 | 9 | 0.94 | 1Score > 41 indicates identity Score > 21 indicates homology |
DFVAQLVSQNIE + Deamidated (NQ) |
| 3147 |
656.3407 | 1966.0003 | 1965.9717 | 14.5 | 1 | 9 | 0.32 | 1Score > 39 indicates identity Score > 16 indicates homology |
VTYQVDADGLLNVTAMEK |
| 3917 |
620.8223 | 2479.2601 | 2479.2304 | 12.0 | 0 | 9 | 0.99 | 1Score > 38 indicates identity Score > 21 indicates homology |
FINNILIQNNIQTAQFNVIME + 3 Deamidated (NQ) |
| 3069 |
952.4939 | 1902.9732 | 1902.9687 | 2.40 | 1 | 9 | 0.5 | 1Score > 40 indicates identity Score > 18 indicates homology |
VLQQNLPTEDIGYSGLR + Deamidated (NQ) |
| 731 |
411.2444 | 820.4742 | 820.4695 | 5.85 | 0 | 9 | 0.65 | 1Score > 37 indicates identity Score > 19 indicates homology |
IFDVISK |
| 1440 |
378.8652 | 1133.5738 | 1133.5717 | 1.85 | 1 | 9 | 0.94 | 1Score > 41 indicates identity Score > 21 indicates homology |
QVTLEPYER |
| 2820 |
877.4692 | 1752.9238 | 1752.8934 | 17.4 | 1 | 9 | 1 | 1Score > 39 indicates identity Score > 21 indicates homology |
LSPETLYLAVNYVDR + Deamidated (NQ) |
| 3608 |
745.4377 | 2233.2913 | 2233.2583 | 14.8 | 1 | 9 | 0.31 | 1Score > 28 indicates identity Score > 16 indicates homology |
SLTRFGFTLIIGGAIGNLIDR |
| 2431 |
784.4327 | 1566.8508 | 1566.8365 | 9.14 | 1 | 9 | 0.65 | 1Score > 38 indicates identity Score > 19 indicates homology |
VSVQNEAPLQAAALR + Deamidated (NQ) |
| 1659 |
610.8376 | 1219.6606 | 1219.6561 | 3.76 | 0 | 9 | 0.59 | 1Score > 40 indicates identity Score > 19 indicates homology |
ISLGLFSNVNR + Deamidated (NQ) |
| 2584 |
816.4177 | 1630.8208 | 1630.8025 | 11.3 | 1 | 9 | 0.72 | 1Score > 41 indicates identity Score > 20 indicates homology |
CAFRVLLPSDPVQE + Deamidated (NQ) |
| 3769 |
1175.5811 | 2349.1476 | 2349.1488 | -0.50 | 1 | 9 | 0.99 | 1Score > 39 indicates identity Score > 21 indicates homology |
HVYIVSQNFVNNQLVISSER + 4 Deamidated (NQ) |
| 2236 |
739.3527 | 1476.6908 | 1476.7018 | -7.38 | 1 | 9 | 0.83 | 1Score > 40 indicates identity Score > 20 indicates homology |
QMTLVLEAQQLGE + 2 Deamidated (NQ); Oxidation (M) |
| 2763 |
860.4600 | 1718.9054 | 1718.9025 | 1.69 | 1 | 9 | 0.93 | 1Score > 39 indicates identity Score > 21 indicates homology |
GSTLGASGPQYVMVPKK |
| 2200 |
488.6225 | 1462.8457 | 1462.8243 | 14.6 | 0 | 9 | 0.55 | 1Score > 34 indicates identity Score > 18 indicates homology |
KPTTTTTATTSILK |
| 3724 |
770.7734 | 2309.2984 | 2309.2631 | 15.3 | 1 | 9 | 0.66 | 1Score > 31 indicates identity Score > 19 indicates homology |
TLTNLELLSLSFNSLSHVPPK |
| 2267 |
499.2871 | 1494.8395 | 1494.8630 | -15.8 | 1 | 8 | 0.46 | 1Score > 36 indicates identity Score > 18 indicates homology |
ARRPVQDVLTALR + Deamidated (NQ) |
| 1817 |
427.5936 | 1279.7590 | 1279.7798 | -16.3 | 1 | 8 | 0.4 | 1Score > 33 indicates identity Score > 17 indicates homology |
LGRKPIIVCPK |
| 2223 |
738.4002 | 1474.7858 | 1474.7780 | 5.35 | 0 | 8 | 0.61 | 1Score > 40 indicates identity Score > 19 indicates homology |
ANNAILQFLDISR + Deamidated (NQ) |
| 1503 |
580.3612 | 1158.7078 | 1158.7046 | 2.81 | 1 | 8 | 0.36 | 1Score > 31 indicates identity Score > 17 indicates homology |
SLPLLMITKK + Oxidation (M) |
| 2769 |
861.4267 | 1720.8388 | 1720.8056 | 19.3 | 1 | 8 | 0.96 | 1Score > 41 indicates identity Score > 21 indicates homology |
IFNASWDIDGQAQEK |
| 3710 |
768.3847 | 2302.1323 | 2302.1515 | -8.34 | 1 | 8 | 0.76 | 1Score > 39 indicates identity Score > 20 indicates homology |
MSVDISNFPNLALADTPVELR + Deamidated (NQ) |
| 2588 |
816.4540 | 1630.8934 | 1630.9155 | -13.5 | 0 | 8 | 0.95 | 1Score > 37 indicates identity Score > 21 indicates homology |
TLLDAHTHIVGVVTR |
| 3157 |
658.0273 | 1971.0601 | 1971.0612 | -0.55 | 0 | 8 | 0.81 | 1Score > 37 indicates identity Score > 20 indicates homology |
DAFIIGLAQACAVLPGLSR |
| 926 |
906.5001 | 905.4928 | 905.5044 | -12.8 | 0 | 8 | 0.7 | 1Score > 41 indicates identity Score > 19 indicates homology |
AYMLIPAK |
| 1822 |
427.5954 | 1279.7644 | 1279.7864 | -17.2 | 0 | 8 | 0.7 | 1Score > 33 indicates identity Score > 19 indicates homology |
GLSLLVPVQLNK |
| 2129 |
474.8922 | 1421.6548 | 1421.6643 | -6.67 | 0 | 8 | 0.44 | 1Score > 41 indicates identity Score > 17 indicates homology |
MQDLNLAMDALR + 2 Oxidation (M) |
| 2294 |
752.4195 | 1502.8244 | 1502.8279 | -2.28 | 1 | 8 | 0.95 | 1Score > 38 indicates identity Score > 21 indicates homology |
AYEPLIRIICQK |
| 3234 |
674.3521 | 2020.0345 | 2020.0153 | 9.48 | 0 | 8 | 0.38 | 1Score > 39 indicates identity Score > 17 indicates homology |
QVAFASTNIIPGLDFSPDK + Deamidated (NQ) |
| 712 |
403.2310 | 804.4474 | 804.4606 | -16.4 | 1 | 8 | 0.8 | 1Score > 41 indicates identity Score > 20 indicates homology |
KGFANIR |
| 1879 |
655.3295 | 1308.6444 | 1308.6197 | 18.9 | 0 | 8 | 0.97 | 1Score > 41 indicates identity Score > 21 indicates homology |
GLNNGLDFATASK + 2 Deamidated (NQ) |
| 2926 |
603.6457 | 1807.9153 | 1807.9152 | 0.061 | 1 | 8 | 0.86 | 1Score > 40 indicates identity Score > 20 indicates homology |
LQGLNQLSHRMHYPV + Oxidation (M) |
| 2968 |
613.9786 | 1838.9140 | 1838.9414 | -14.9 | 0 | 8 | 0.55 | 1Score > 40 indicates identity Score > 18 indicates homology |
GLPADTFLNVNVPDLPR + 2 Deamidated (NQ) |
| 3000 |
929.9785 | 1857.9424 | 1857.9796 | -20.0 | 1 | 8 | 0.71 | 1Score > 40 indicates identity Score > 19 indicates homology |
LSGAKVTAVTDVNQDLAR + Deamidated (NQ) |
| 2754 |
857.4437 | 1712.8728 | 1712.8733 | -0.29 | 0 | 8 | 0.85 | 1Score > 40 indicates identity Score > 20 indicates homology |
IDDAQQIVWQDLIR + Deamidated (NQ) |
| 754 |
417.2201 | 832.4256 | 832.4225 | 3.74 | 1 | 8 | 0.71 | 1Score > 43 indicates identity Score > 19 indicates homology |
GKGCVGGAK |
| 2693 |
840.9500 | 1679.8854 | 1679.8882 | -1.66 | 1 | 8 | 0.83 | 1Score > 39 indicates identity Score > 20 indicates homology |
SILHWITAPLSEADK |
| 863 |
439.2639 | 876.5132 | 876.5102 | 3.43 | 1 | 8 | 0.92 | 1Score > 37 indicates identity Score > 21 indicates homology |
ASMISKLK |
| 2002 |
456.2305 | 1365.6697 | 1365.6572 | 9.17 | 1 | 8 | 0.59 | 1Score > 41 indicates identity Score > 19 indicates homology |
QSNKVHMGHTAR + Deamidated (NQ) |
| 2086 |
468.9312 | 1403.7718 | 1403.7772 | -3.88 | 1 | 8 | 0.62 | 1Score > 38 indicates identity Score > 19 indicates homology |
LLYNNIKDNGLK |
| 3790 |
592.7963 | 2367.1561 | 2367.1628 | -2.83 | 1 | 8 | 0.41 | 1Score > 39 indicates identity Score > 17 indicates homology |
STVEALQSGMIYGVAGQVDGLVR + 2 Deamidated (NQ); Oxidation (M) |
| 1808 |
639.8401 | 1277.6656 | 1277.6615 | 3.21 | 1 | 8 | 0.99 | 1Score > 41 indicates identity Score > 21 indicates homology |
LVELVFNSNSR + Deamidated (NQ) |
| 3446 |
717.3921 | 2149.1545 | 2149.1743 | -9.20 | 1 | 8 | 0.41 | 1Score > 36 indicates identity Score > 17 indicates homology |
IQVTGSPAILQNPQVQAKVR + 3 Deamidated (NQ) |
| 3738 |
773.4311 | 2317.2715 | 2317.3045 | -14.3 | 1 | 8 | 0.24 | 1Score > 34 indicates identity Score > 15 indicates homology |
ATPAPPLGPALGQKQIQIAAFVK + 2 Deamidated (NQ) |
| 1998 |
683.3270 | 1364.6394 | 1364.6554 | -11.7 | 0 | 8 | 0.85 | 1Score > 41 indicates identity Score > 20 indicates homology |
YWLYPYGTFR |
| 864 |
440.2508 | 878.4870 | 878.4861 | 1.04 | 1 | 8 | 0.33 | 1Score > 39 indicates identity Score > 16 indicates homology |
KAAVQYAK + Deamidated (NQ) |
| 4769 |
1049.7650 | 4195.0309 | 4195.0547 | -5.68 | 1 | 8 | 1 | 1Score > 32 indicates identity Score > 21 indicates homology |
SFMHLDTVFTMVNFAQFTIHPAIQNQQGELNVYILE |
| 2351 |
765.4367 | 1528.8588 | 1528.8613 | -1.58 | 1 | 8 | 0.8 | 1Score > 37 indicates identity Score > 20 indicates homology |
KLLAAFPNLANLSR + 2 Deamidated (NQ) |
| 2634 |
414.9654 | 1655.8325 | 1655.8454 | -7.77 | 0 | 8 | 0.7 | 1Score > 40 indicates identity Score > 19 indicates homology |
GLCTAQAWQPGQLVK |
| 2485 |
529.9633 | 1586.8681 | 1586.8780 | -6.26 | 1 | 8 | 0.73 | 1Score > 38 indicates identity Score > 19 indicates homology |
AQINTIAHKQIVLH + 2 Deamidated (NQ) |
| 3573 |
737.3922 | 2209.1548 | 2209.1477 | 3.19 | 1 | 8 | 0.82 | 1Score > 38 indicates identity Score > 20 indicates homology |
SGIILVNNQDIALLNPNEIR + 4 Deamidated (NQ) |
| 678 |
395.7091 | 789.4036 | 789.4021 | 1.96 | 0 | 8 | 0.94 | 1Score > 42 indicates identity Score > 20 indicates homology |
SPNFTPK |
| 1866 |
435.2605 | 1302.7597 | 1302.7395 | 15.5 | 0 | 8 | 0.26 | 1Score > 34 indicates identity Score > 15 indicates homology |
IVLVVNSGSSSIK + Deamidated (NQ) |
| 2986 |
617.9910 | 1850.9512 | 1850.9639 | -6.87 | 1 | 8 | 0.79 | 1Score > 39 indicates identity Score > 20 indicates homology |
GKPTDLSIHETAWGLAR |
| 524 |
718.3870 | 717.3797 | 717.3657 | 19.5 | 0 | 8 | 0.89 | 1Score > 44 indicates identity Score > 20 indicates homology |
QALSGDK |
| 2861 |
591.9728 | 1772.8966 | 1772.8866 | 5.64 | 1 | 8 | 0.86 | 1Score > 40 indicates identity Score > 20 indicates homology |
NDMVENIVNQLIQLK + 3 Deamidated (NQ) |
| 2015 |
457.9160 | 1370.7262 | 1370.7266 | -0.32 | 1 | 8 | 0.32 | 1Score > 40 indicates identity Score > 16 indicates homology |
EGRPSTNATLVAR |
| 3071 |
953.9197 | 1905.8248 | 1905.8488 | -12.6 | 0 | 8 | 0.19 | 1Score > 36 indicates identity Score > 13 indicates homology |
TLQDMMNIIDYNQYK + Deamidated (NQ); Oxidation (M) |
| 3277 |
513.2542 | 2048.9877 | 2048.9646 | 11.3 | 1 | 8 | 0.54 | 1Score > 40 indicates identity Score > 18 indicates homology |
LGIPMSVLMGANIASEVADE + Deamidated (NQ); 2 Oxidation (M) |
| 1973 |
451.9030 | 1352.6872 | 1352.6837 | 2.59 | 0 | 8 | 0.7 | 1Score > 40 indicates identity Score > 19 indicates homology |
HVNQAPASPYLR + Deamidated (NQ) |
| 2962 |
919.5073 | 1837.0000 | 1836.9846 | 8.39 | 1 | 8 | 0.45 | 1Score > 36 indicates identity Score > 17 indicates homology |
TARGPAAGAQLLPGPVGSFA |
| 3361 |
704.3713 | 2110.0921 | 2110.0921 | -0.014 | 1 | 8 | 0.55 | 1Score > 38 indicates identity Score > 18 indicates homology |
LLFNDIIFRMPNPNYVK + Deamidated (NQ); Oxidation (M) |
| 3515 |
729.4009 | 2185.1809 | 2185.1518 | 13.3 | 0 | 8 | 0.75 | 1Score > 36 indicates identity Score > 19 indicates homology |
TALQSALTTAFAYGSTVLIQK + 2 Deamidated (NQ) |
| 2089 |
469.2682 | 1404.7828 | 1404.7572 | 18.2 | 0 | 8 | 0.81 | 1Score > 37 indicates identity Score > 20 indicates homology |
SIASLLSITNGSSR |
| 3106 |
966.0433 | 1930.0720 | 1930.0524 | 10.2 | 0 | 8 | 0.93 | 1Score > 34 indicates identity Score > 20 indicates homology |
QSALVQVFNKPVQTITR + 2 Deamidated (NQ) |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/