MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita6 sp
MS data file : PRT1270_T-BRSC_6_20250714122635.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 23:38:56 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,869

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 121–130 (out of 187)


Page: Previous 1 8 9 10 11 12 13 14 15 16 17 18  19 Next 

+121

Accession Score Description
1 RL23_PSEE4 44 50S ribosomal protein L23 OS=Pseudomonas entomophila (strain L48) GN=rplW PE=3 SV=1

+122

Accession Score Description
1 FKBP_DEBHA 43 FK506-binding protein 1 OS=Debaryomyces hansenii GN=FPR1 PE=3 SV=1

+123

Accession Score Description
1 SYD_HAEIE 43 Aspartyl-tRNA synthetase OS=Haemophilus influenzae (strain PittEE) GN=aspS PE=3 SV=1

+124

Accession Score Description
1 IF2_NOVAD 42 Translation initiation factor IF-2 OS=Novosphingobium aromaticivorans (strain DSM 12444) GN=infB PE=3 SV=1

+125

Accession Score Description
1 SYR_EUBR3 42 Arginyl-tRNA synthetase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=argS PE=3 SV=1

-126

Accession Score Description
1 MURA_PSEPG 41 UDP-N-acetylglucosamine 1-carboxyvinyltransferase OS=Pseudomonas putida (strain GB-1) GN=murA PE=3 SV=1
Score Mass Matches Sequences emPAI
126.1 MURA_PSEPG 41 45067 1 (1) 1 (1) 0.05
UDP-N-acetylglucosamine 1-carboxyvinyltransferase OS=Pseudomonas putida (strain GB-1) GN=murA PE=3 SV=1
5 samesets of MURA_PSEPG
MURA_PSEPK 41 45059 1 (1) 1 (1) 0.05
UDP-N-acetylglucosamine 1-carboxyvinyltransferase OS=Pseudomonas putida (strain KT2440) GN=murA PE=3 SV=1
MURA_PSEPU 41 44885 1 (1) 1 (1) 0.05
UDP-N-acetylglucosamine 1-carboxyvinyltransferase OS=Pseudomonas putida GN=murA PE=3 SV=1
MURA_PSEPW 41 44988 1 (1) 1 (1) 0.05
UDP-N-acetylglucosamine 1-carboxyvinyltransferase OS=Pseudomonas putida (strain W619) GN=murA PE=3 SV=1
MURA_PSEP1 41 45059 1 (1) 1 (1) 0.05
UDP-N-acetylglucosamine 1-carboxyvinyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=murA PE=3 SV=1
MURA_PSEE4 41 44999 1 (1) 1 (1) 0.05
UDP-N-acetylglucosamine 1-carboxyvinyltransferase OS=Pseudomonas entomophila (strain L48) GN=murA PE=3 SV=1

-1 peptide matches (1 non-duplicate, 0 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
4707   967.2949 3865.1505 3865.0812 17.9 1 41 0.0019 +1Score > 26 indicates identity U K.NAALPILAATLLADGPVTVGNLPHLHDITTMIELFGR.M + Deamidated (NQ)

+127

Accession Score Description
1 GLO2_RHOPB 41 Hydroxyacylglutathione hydrolase OS=Rhodopseudomonas palustris (strain BisB18) GN=gloB PE=3 SV=1

+128

Accession Score Description
1 Y041_SYNY3 41 Putative methyl-accepting chemotaxis protein sll0041 OS=Synechocystis sp. (strain PCC 6803) GN=sll0041 PE=3 SV=2

+129

Accession Score Description
1 RS7_AZOVD 40 30S ribosomal protein S7 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rpsG PE=3 SV=1

+130

Accession Score Description
1 PHS_PSEAB 41 Putative pterin-4-alpha-carbinolamine dehydratase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=PA14_53000 PE=3 SV=1
Page: Previous 1 8 9 10 11 12 13 14 15 16 17 18  19 Next 

Not what you expected? Try the select summary.