MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita5 sp
MS data file : PRT1270_T-BRSC_5_20250714121805.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 23:42:02 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,997

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 2901–3000 (out of 3818)

Page: Previous 1 …25 26 27 28 29 30 31 32 33 34 35 … 39 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3017 656.3804 1966.1194 1966.1112 4.15 1 0 1 +1Score > 33 indicates identity
Score > 13 indicates homology		 VFNAAQKGLPVAAGVQALGR
4813 810.0005 4044.9661 4044.9475 4.60 1 0 1 +1Score > 33 indicates identity
Score > 13 indicates homology		 TVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFK + 6 Deamidated (NQ); 2 Oxidation (M)
4420 771.3953 3081.5521 3081.5077 14.4 1 0 1 +1Score > 36 indicates identity
Score > 13 indicates homology		 DQVIVCNIGHFDNEIQVDALNALAGVQK + 2 Deamidated (NQ)
4755 951.5178 3802.0421 3801.9785 16.7 1 0 1 +1Score > 30 indicates identity
Score > 13 indicates homology		 VSLAIMVAALGLDTVPTMVFDEVDTGIGGAIADIVGQK + Oxidation (M)
3877 831.0952 2490.2638 2490.2431 8.31 1 0 0.97 +1Score > 38 indicates identity
Score > 13 indicates homology		 IQALYDQPFLDLVFEAQSVHR + 2 Deamidated (NQ)
4212 946.4886 2836.4440 2836.4429 0.37 1 0 1 +1Score > 36 indicates identity
Score > 13 indicates homology		 KAFSTDTQAPFGGIIAVNRPLDMATAK + Deamidated (NQ); Oxidation (M)
2475 828.4815 1654.9484 1654.9189 17.9 1 0 1 +1Score > 34 indicates identity
Score > 13 indicates homology		 LVQPGSIIVRQCGTK
4293 970.8685 2909.5837 2909.5354 16.6 0 0 1 +1Score > 32 indicates identity
Score > 13 indicates homology		 MNLTKPLLLSALAGLTACANLDLPDQR + Deamidated (NQ)
4647 861.4497 3441.7697 3441.7458 6.94 1 0 1 +1Score > 34 indicates identity
Score > 13 indicates homology		 SVLDAAQIVGLNCLRLMNDMTAVALNYGIYK + Oxidation (M)
4732 926.9885 3703.9249 3703.8549 18.9 0 0 0.96 +1Score > 33 indicates identity
Score > 13 indicates homology		 IQPLDFVTFTQYDPALPVVVAFEPQNLNNILGE + 3 Deamidated (NQ)
2832 927.5198 1853.0250 1852.9934 17.1 1 0 1 +1Score > 36 indicates identity
Score > 13 indicates homology		 FAAENGLPILNNVLLPR + 3 Deamidated (NQ)
3953 641.6092 2562.4077 2562.4381 -11.9 0 0 1 +1Score > 33 indicates identity
Score > 13 indicates homology		 TQGLVIGADTIVVLGDKPLGKPTNR + Deamidated (NQ)
4141 555.0922 2770.4246 2770.3701 19.7 0 0 1 +1Score > 36 indicates identity
Score > 13 indicates homology		 ATPSQVINWTQGQVIIATGSPFDPIE + 2 Deamidated (NQ)
4227 954.1376 2859.3910 2859.4099 -6.63 0 0 1 +1Score > 38 indicates identity
Score > 13 indicates homology		 FINTMSQVPTISQLLPLPASDDDDLK + 2 Deamidated (NQ)
4522 1074.5470 3220.6192 3220.6472 -8.69 1 0 1 +1Score > 36 indicates identity
Score > 13 indicates homology		 VMPLDILATHLLRDLLAGDTDSAQALGCLE
846 910.4918 909.4845 909.4920 -8.17 0 0 1 +1Score > 39 indicates identity
Score > 13 indicates homology		 IPDQLPAR + Deamidated (NQ)
4574 827.7100 3306.8109 3306.7890 6.62 0 0 0.94 +1Score > 30 indicates identity
Score > 13 indicates homology		 ISLGQLITYNALLVFFTEPLQNIINLQVK + 5 Deamidated (NQ)
4619 678.1517 3385.7221 3385.7340 -3.51 1 0 1 +1Score > 34 indicates identity
Score > 13 indicates homology		 TNQGGLLQVRCDGVAVIFAHNQIFIGLSNIK + 4 Deamidated (NQ)
4639 857.2211 3424.8553 3424.7953 17.5 1 0 0.95 +1Score > 30 indicates identity
Score > 13 indicates homology		 GTLTVGDLVMVNQLVFQLSVPLNFLGSVYRE + Deamidated (NQ); Oxidation (M)
2162 757.9533 1513.8920 1513.8940 -1.30 1 0 0.98 +1Score > 31 indicates identity
Score > 13 indicates homology		 LLVVSSGSIALGRSR
4055 672.0693 2684.2481 2684.2606 -4.65 1 0 1 +1Score > 37 indicates identity
Score > 13 indicates homology		 KFISITVDGVTYNATPNTHSNFQE + 2 Deamidated (NQ)
3545 749.4064 2245.1974 2245.2318 -15.3 1 0 1 +1Score > 37 indicates identity
Score > 13 indicates homology		 SGLLVQLANLPQQPESVPINK + Deamidated (NQ)
4540 813.4572 3249.7997 3249.7359 19.6 1 0 1 +1Score > 29 indicates identity
Score > 13 indicates homology		 FGNAVILLYIQHSDSKDINFLLALAMTLK + 2 Deamidated (NQ)
4624 1132.6106 3394.8100 3394.7919 5.33 1 0 1 +1Score > 32 indicates identity
Score > 13 indicates homology		 LRVDGGASSNDLLMQFQADLLGIPVIRPAVTE
4416 1027.5287 3079.5643 3079.5111 17.3 0 0 1 +1Score > 36 indicates identity
Score > 13 indicates homology		 TLKPGPQQNWASKPQDNNVSNWGGAASVK + Deamidated (NQ)
4857 1047.0100 4184.0109 4183.9659 10.7 1 0 1 +1Score > 33 indicates identity
Score > 13 indicates homology		 EHAPWSLADYGIQVMIAPSFADIFYGNSINNQMVPVR + 2 Deamidated (NQ); 2 Oxidation (M)
4557 1092.8628 3275.5666 3275.6245 -17.7 0 0 1 +1Score > 36 indicates identity
Score > 13 indicates homology		 MSQGGGLNILSIQSSVAYGHVGNSAAVFPLQR + 2 Deamidated (NQ); Oxidation (M)
4970 1040.5509 6237.2617 6237.1531 17.4 1 0 1 +1Score > 27 indicates identity
Score > 13 indicates homology		 MATWSNFNLQNSASPLMEQIIFFHDHTLVILIMITILVGYLMISLFFNSYINR + 2 Deamidated (NQ); Oxidation (M)
4173 931.8464 2792.5174 2792.5000 6.22 1 0 1 +1Score > 33 indicates identity
Score > 13 indicates homology		 LLDQLFIPTQGQIDLTPYKNFLSK + Deamidated (NQ)
4486 1056.2467 3165.7183 3165.6670 16.2 1 0 1 +1Score > 31 indicates identity
Score > 13 indicates homology		 FGLLLDPDNNNTVLQPSTTAAVKLQVSPGR + Deamidated (NQ)
4681 891.2112 3560.8157 3560.7746 11.5 1 0 1 +1Score > 34 indicates identity
Score > 13 indicates homology		 SQAIHNIQNLYISDSNNSNNPILAPNPQIKIE + 2 Deamidated (NQ)
4859 1049.7668 4195.0381 4195.0547 -3.96 1 0 1 +1Score > 32 indicates identity
Score > 13 indicates homology		 SFMHLDTVFTMVNFAQFTIHPAIQNQQGELNVYILE
4880 1109.3057 4433.1937 4433.2476 -12.1 1 0 1 +1Score > 31 indicates identity
Score > 13 indicates homology		 NTVKVTGVVVFMFSLSWQLSLVTFMGFPIIMMVSNIYGK + 2 Deamidated (NQ); 3 Oxidation (M)
4328 988.7867 2963.3383 2963.3205 6.01 1 0 1 +1Score > 35 indicates identity
Score > 13 indicates homology		 DKNFGFNAQDMQYVDMIQAGIIDPAK + 3 Deamidated (NQ); 2 Oxidation (M)
4632 1138.6024 3412.7854 3412.8282 -12.6 1 0 1 +1Score > 33 indicates identity
Score > 13 indicates homology		 WTPDLIVVNKSEPVVLIINSPQVDTGFYLR + Deamidated (NQ)
261 634.2910 633.2837 633.2792 7.14 0 0 1 +1Score > 41 indicates identity
Score > 13 indicates homology		 AGMDPK + Oxidation (M)
3624 767.7513 2300.2321 2300.2410 -3.88 1 0 1 +1Score > 36 indicates identity
Score > 13 indicates homology		 QVLSAGVDGIAVVSAVMGASDVKK
3990 870.1309 2607.3709 2607.3804 -3.67 0 0 1 +1Score > 36 indicates identity
Score > 13 indicates homology		 TMGIPTMILLGHSLGGFLATSYSIK
4872 876.4598 4377.2626 4377.3253 -14.3 1 0 1 +1Score > 30 indicates identity
Score > 13 indicates homology		 LAVAASVTLAVLAGVRLYNQNDALPQMAQQGTTPQIALPQVK + 3 Deamidated (NQ); Oxidation (M)
4488 793.4680 3169.8429 3169.8155 8.65 1 0 1 +1Score > 24 indicates identity
Score > 13 indicates homology		 LGTNIIAILLIIYGFSLVSGISVRQFFSK + Deamidated (NQ)
4628 681.1683 3400.8051 3400.7880 5.02 1 0 1 +1Score > 32 indicates identity
Score > 13 indicates homology		 GARAVVVGASNIVGKPMAMLLLQGGATVTICNSK + 2 Deamidated (NQ); Oxidation (M)
2436 544.6601 1630.9585 1630.9294 17.8 1 0 1 +1Score > 31 indicates identity
Score > 13 indicates homology		 KGVLSPVVDINISYK
3726 787.7590 2360.2552 2360.2708 -6.62 1 0 1 +1Score > 36 indicates identity
Score > 13 indicates homology		 FLAFLSLINLFLFVGLEFQE + Deamidated (NQ)
4490 1059.5109 3175.5109 3175.4954 4.88 1 0 1 +1Score > 36 indicates identity
Score > 13 indicates homology		 KPPLFNMNAMSALYHIAQNDSPTLQSRE + 3 Deamidated (NQ)
4654 867.4663 3465.8361 3465.8258 2.97 1 0 1 +1Score > 32 indicates identity
Score > 13 indicates homology		 LLLKGAPLTVAPLVQVVLDPTFTNPWHYMSE + Deamidated (NQ); Oxidation (M)
4985 802.0479 6408.3250 6408.2162 17.0 0 0 1 +1Score > 26 indicates identity
Score > 13 indicates homology		 SSDGLSLLFVVLWLAGDVFNLMGAVMQHLLSTMIILAAYYTVADIILLGQCLWYDNE + Deamidated (NQ); 2 Oxidation (M)
3553 750.3873 2248.1401 2248.1376 1.11 0 0 1 +1Score > 38 indicates identity
Score > 13 indicates homology		 VNSVAPGPIWTPLQISGGQPTE + Deamidated (NQ)
4939 877.6105 5259.6193 5259.6438 -4.65 1 0 1 +1Score > 29 indicates identity
Score > 13 indicates homology		 TYGAALILLLAAMLAWQPAQAQLRVDISGTGATQYPVAIADFAVDDTHGR + 4 Deamidated (NQ); Oxidation (M)
4014 879.1188 2634.3346 2634.3145 7.61 0 0 1 +1Score > 37 indicates identity
Score > 13 indicates homology		 ASMGGAVIPNFSVGMVLLQQAAAAAAR + 2 Deamidated (NQ); 2 Oxidation (M)
4147 925.5313 2773.5721 2773.5387 12.0 0 0 1 +1Score > 28 indicates identity
Score > 13 indicates homology		 MITLGHMLALGAVLFAISLAGIFLNR + 2 Oxidation (M)
3716 786.4393 2356.2961 2356.2573 16.5 1 0 1 +1Score > 34 indicates identity
Score > 13 indicates homology		 MHQRILILDYGSQVTQLIAR + 2 Deamidated (NQ)
4504 1064.2749 3189.8029 3189.7550 15.0 1 0 1 +1Score > 28 indicates identity
Score > 13 indicates homology		 FFATGLAYLGAGISILAAGLAGIGQGLAAARAVE
4576 662.3732 3306.8296 3306.7693 18.2 0 0 1 +1Score > 29 indicates identity
Score > 13 indicates homology		 HLPSLPITFVAGQIGSILIQLPVPYFWNGE + Deamidated (NQ)
4877 1107.3325 4425.3009 4425.3806 -18.0 0 0 1 +1Score > 31 indicates identity
Score > 13 indicates homology		 MMLGTLVLLASLALLWAGGVSYGNMAGVALIFYTLLTVLQPE + Oxidation (M)
4038 890.1630 2667.4672 2667.4629 1.59 1 0 0.99 +1Score > 32 indicates identity
Score > 13 indicates homology		 VSISIAPNCVRLVTLATANQLSVIE
4042 892.0948 2673.2626 2673.2753 -4.77 0 0 1 +1Score > 38 indicates identity
Score > 13 indicates homology		 VSMGLKPANMIWLWGQGPAPSMPR + 2 Deamidated (NQ); 3 Oxidation (M)
4529 1078.5189 3232.5349 3232.4776 17.7 1 0 1 +1Score > 36 indicates identity
Score > 13 indicates homology		 MEFFTMCMLAAGFGMAIGAFGTGIGQGLAVK + Deamidated (NQ); 3 Oxidation (M)
4659 872.4497 3485.7697 3485.7343 10.2 1 0 1 +1Score > 35 indicates identity
Score > 13 indicates homology		 IMLITVGNEILMSNDPNLVNQLLPAMQNVQK + 4 Deamidated (NQ); 2 Oxidation (M)
3507 558.5078 2230.0021 2229.9969 2.31 1 0 1 +1Score > 38 indicates identity
Score > 13 indicates homology		 NCVQTTLGGRDVFWCMLR + 2 Deamidated (NQ); Oxidation (M)
4785 782.4260 3907.0936 3907.1699 -19.5 1 0 1 +1Score > 30 indicates identity
Score > 13 indicates homology		 ILQSGMTLLLLLIWFRPVADFASDIQHRIVQWK
4928 835.4433 5006.6161 5006.6119 0.86 0 0 1 +1Score > 28 indicates identity
Score > 13 indicates homology		 YDWLPQIGFSWAVSVDGISMPLVLLAGFVTTLSMLAAWQVNLKPR + Deamidated (NQ); Oxidation (M)
3376 1084.5825 2167.1504 2167.1412 4.26 1 0 1 +1Score > 37 indicates identity
Score > 13 indicates homology		 VIDFLKSYNLVNDSVLAQK + 2 Deamidated (NQ)
4377 1010.5602 3028.6588 3028.6134 15.0 1 0 1 +1Score > 31 indicates identity
Score > 13 indicates homology		 KYITAHGLPPTASALGPGPPPPEPLPGSGPR
1 303.1785 302.1712
2 303.1788 302.1715
3 304.1627 303.1554
4 304.1628 303.1555
5 305.0113 304.0040
6 317.2193 316.2120
7 317.2193 316.2120
8 317.2194 316.2121
9 321.6836 320.6763
10 322.1888 321.1815
11 329.6988 328.6915
12 331.2350 330.2277
13 331.2350 330.2277
14 331.6912 330.6839
15 333.1896 332.1823
16 333.2143 332.2070
17 343.2048 342.1975
18 345.2255 344.2182
19 345.2258 344.2185
20 345.2259 344.2186
21 345.2259 344.2186
22 345.2264 344.2191
23 347.2302 346.2229
24 351.2021 350.1948
25 351.2390 350.2317
26 351.8656 350.8583
27 353.2565 352.2492
28 354.1801 353.1728
29 355.2710 354.2637
30 359.2414 358.2341
31 359.2415 358.2342
32 359.2415 358.2342
33 359.2415 358.2342
34 359.2416 358.2343
35 359.2420 358.2347
36 359.2661 358.2588
37 360.2256 359.2183
Page: Previous 1 …25 26 27 28 29 30 31 32 33 34 35 … 39 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/