MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita5 sp
MS data file : PRT1270_T-BRSC_5_20250714121805.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 23:42:02 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,997

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 2601–2700 (out of 3818)

Page: Previous 1 …22 23 24 25 26 27 28 29 30 31 32 … 39 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
4298 973.8688 2918.5846 2918.5324 17.9 1 2 1 +1Score > 33 indicates identity
Score > 15 indicates homology		 AINHAMAAGVPIVFAINKVDKPTANPDK + Deamidated (NQ); Oxidation (M)
4657 868.4503 3469.7721 3469.7585 3.91 1 2 1 +1Score > 35 indicates identity
Score > 15 indicates homology		 SNDPIDVVLIGGGIMSATLGAMIQRVQPGWSIR + 3 Deamidated (NQ); Oxidation (M)
295 327.2035 652.3924 652.4020 -14.7 1 2 0.9 +1Score > 30 indicates identity
Score > 14 indicates homology		 HAKGIK
4348 997.5318 2989.5736 2989.5814 -2.62 1 2 1 +1Score > 34 indicates identity
Score > 15 indicates homology		 FDLNVSKSAWLTAIPLAQQFWQTVAR
3853 617.5779 2466.2825 2466.2729 3.88 0 2 1 +1Score > 37 indicates identity
Score > 15 indicates homology		 GNAVAINAFVPLANMFGYINTLR + Deamidated (NQ)
4297 729.8392 2915.3277 2915.3018 8.88 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 VWMYSSSQASAIKDAQDALPSTLNDAE + 2 Deamidated (NQ); Oxidation (M)
4422 1028.5282 3082.5628 3082.5363 8.57 1 2 0.85 +1Score > 36 indicates identity
Score > 14 indicates homology		 LTKNNSVIMPTTMAVMALLNLYFYMR + 3 Oxidation (M)
4600 1114.9404 3341.7994 3341.8210 -6.46 1 2 1 +1Score > 32 indicates identity
Score > 15 indicates homology		 LNHNHMLLWLLLIGTVPVGIAGLLFNKQAE + 2 Deamidated (NQ); Oxidation (M)
4642 1144.2588 3429.7546 3429.7384 4.71 0 2 0.7 +1Score > 34 indicates identity
Score > 13 indicates homology		 GALLIVDSTFASPPLQYAWNFGADIVLYSATK + 2 Deamidated (NQ)
1197 1061.5338 1060.5265 1060.5149 11.0 1 2 0.77 +1Score > 42 indicates identity
Score > 13 indicates homology		 GALDTSGVEGR
3363 1079.5682 2157.1218 2157.1391 -8.00 1 2 1 +1Score > 38 indicates identity
Score > 15 indicates homology		 ELMQTLTPLLHQLQFLSK + 2 Deamidated (NQ); Oxidation (M)
4080 676.8571 2703.3993 2703.4041 -1.77 1 2 0.89 +1Score > 36 indicates identity
Score > 14 indicates homology		 QCLDDLLLINVVDEYISGVQIVGK + Deamidated (NQ)
4271 965.4946 2893.4620 2893.4167 15.6 1 2 0.73 +1Score > 36 indicates identity
Score > 13 indicates homology		 SDFLLHILSAMYGNLDSQIIELDNR + Deamidated (NQ); Oxidation (M)
4313 979.1783 2934.5131 2934.5643 -17.5 0 2 0.88 +1Score > 36 indicates identity
Score > 14 indicates homology		 GVNTYIPLIIPGFPYPTAAAAATTAAAFR
108 446.2738 445.2665 445.2649 3.70 1 2 1 +1Score > 44 indicates identity
Score > 14 indicates homology		 KGGGK
4011 878.4547 2632.3423 2632.3306 4.44 1 2 0.89 +1Score > 37 indicates identity
Score > 14 indicates homology		 VQSYLTSTSSTFKLADTVILICGE
3166 687.0237 2058.0493 2058.0269 10.9 1 2 0.97 +1Score > 39 indicates identity
Score > 14 indicates homology		 VGLNPQALFNQGVSLDEVR + 3 Deamidated (NQ)
3691 779.7537 2336.2393 2336.2277 4.95 1 2 0.9 +1Score > 36 indicates identity
Score > 14 indicates homology		 WLYEQVLDQLQQHVPALTR
3271 707.3688 2119.0846 2119.0732 5.38 1 2 0.92 +1Score > 39 indicates identity
Score > 14 indicates homology		 NGLCTIVAFNKNVDDQLAK
3952 855.1329 2562.3769 2562.3661 4.18 0 2 0.71 +1Score > 35 indicates identity
Score > 13 indicates homology		 TNKPSKPLNPMINAGALAVTHMIK + Deamidated (NQ); Oxidation (M)
4395 764.1478 3052.5621 3052.5110 16.7 1 2 1 +1Score > 35 indicates identity
Score > 14 indicates homology		 SLFAMPQQVDSLALAAAHGVPGRQVACLE + Deamidated (NQ); Oxidation (M)
4833 814.6780 4068.3536 4068.3294 5.96 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 LNLPFNISPHVFVFILSFAFSLILGPVLIPMLTRLK + 2 Deamidated (NQ)
4001 874.4794 2620.4164 2620.3804 13.7 0 2 0.94 +1Score > 34 indicates identity
Score > 14 indicates homology		 TIWLLIPGWPLAFMWYISTLAE
3487 738.0330 2211.0772 2211.0565 9.35 1 2 0.82 +1Score > 39 indicates identity
Score > 14 indicates homology		 PVVSLAQMMESGVHFGHQTR + Deamidated (NQ)
4384 760.3912 3037.5357 3037.5495 -4.55 1 2 1 +1Score > 36 indicates identity
Score > 14 indicates homology		 VAIHAQGLNLILGGKTLLDNFDIDINAGE + 4 Deamidated (NQ)
2802 913.9405 1825.8664 1825.8377 15.7 1 2 0.89 +1Score > 40 indicates identity
Score > 14 indicates homology		 GDGHMGDLPRLSANADGK + Oxidation (M)
3319 1068.6069 2135.1992 2135.1739 11.9 1 2 0.83 +1Score > 32 indicates identity
Score > 14 indicates homology		 WLPSLNPLDINVVVTGKDR
4409 1023.9091 3068.7055 3068.6699 11.6 1 2 1 +1Score > 30 indicates identity
Score > 14 indicates homology		 VLVIGASTGYGLAARIAAAFGVGAATLGVFFE
4553 817.4103 3265.6121 3265.5668 13.9 1 2 0.81 +1Score > 36 indicates identity
Score > 13 indicates homology		 ISTLNDECQYPLDIALAQGNANIACMLIK + Deamidated (NQ); Oxidation (M)
4272 724.6489 2894.5665 2894.5133 18.4 1 2 0.98 +1Score > 33 indicates identity
Score > 14 indicates homology		 IADMIINGVMIAGNDNGLLLPRIVKPE + 3 Deamidated (NQ); Oxidation (M)
3868 827.4246 2479.2520 2479.2707 -7.55 1 2 0.98 +1Score > 38 indicates identity
Score > 14 indicates homology		 GYGILQPDPPVNITVSAVDRNPR + 2 Deamidated (NQ)
4019 659.8152 2635.2317 2635.2463 -5.53 0 2 0.75 +1Score > 37 indicates identity
Score > 13 indicates homology		 TQLGQQLQMLGTITPDPTVTPTFE + 4 Deamidated (NQ); Oxidation (M)
4354 998.5004 2992.4794 2992.5150 -11.9 0 2 1 +1Score > 37 indicates identity
Score > 14 indicates homology		 ALCAQTMLVSHPGVNVLLLDDGLQHYK + Deamidated (NQ)
4808 804.2400 4016.1636 4016.2386 -18.7 0 2 1 +1Score > 28 indicates identity
Score > 14 indicates homology		 MQYLISSLIFLIPSLGMLAGLSAAATVTIFLLISFLR + Deamidated (NQ); 2 Oxidation (M)
2664 586.3844 1756.1314 1756.0974 19.3 1 2 1.7 +1Score > 17 indicates identity IPIVIVANKADLLHLK
3492 555.0664 2216.2365 2216.1940 19.2 0 2 0.92 +1Score > 32 indicates identity
Score > 14 indicates homology		 VAVQDILYDPQTSGGLLISVK + Deamidated (NQ)
4858 1049.7653 4195.0321 4195.0547 -5.39 1 2 1 +1Score > 32 indicates identity
Score > 14 indicates homology		 CFVNFSLFQSLPDAWGIDQIFPIMPLSGLDQQPTRR + 2 Deamidated (NQ)
2959 641.6884 1922.0434 1922.0810 -19.6 1 2 0.98 +1Score > 36 indicates identity
Score > 14 indicates homology		 QALARQQQLTKPAGSLGR
3111 1015.0075 2028.0004 2027.9696 15.2 1 2 0.82 +1Score > 40 indicates identity
Score > 13 indicates homology		 VNAVNCNTSWKITLFMK + 3 Deamidated (NQ)
4487 1057.6200 3169.8382 3169.8155 7.16 1 2 1 +1Score > 24 indicates identity
Score > 14 indicates homology		 LGTNIIAILLIIYGFSLVSGISVRQFFSK + Deamidated (NQ)
2662 439.5112 1754.0157 1753.9872 16.2 1 2 1 +1Score > 32 indicates identity
Score > 14 indicates homology		 NLIAAMQKLVPSNLAR + Oxidation (M)
4439 1035.5640 3103.6702 3103.6702 0.0068 1 2 1 +1Score > 32 indicates identity
Score > 14 indicates homology		 MPLLGGMVVTAIVTYGLLLLEDAGFRPLE + Oxidation (M)
4214 711.3447 2841.3497 2841.3347 5.27 1 2 0.8 +1Score > 37 indicates identity
Score > 13 indicates homology		 QPGTLEVVSGCTMDMLQAVYGLDGIR + 2 Oxidation (M)
2687 884.4736 1766.9326 1766.9601 -15.5 0 2 0.88 +1Score > 39 indicates identity
Score > 14 indicates homology		 QHVVSGLVMSTAPTVLK + Deamidated (NQ)
3572 755.4152 2263.2238 2263.1891 15.3 0 2 0.97 +1Score > 35 indicates identity
Score > 14 indicates homology		 LLDAMVMPGIQGGPLMHVIAGK + Oxidation (M)
3723 787.7574 2360.2504 2360.2376 5.40 0 2 0.95 +1Score > 36 indicates identity
Score > 14 indicates homology		 SLQVQPQVSLKPFNTFGVDVR + 2 Deamidated (NQ)
4043 669.3245 2673.2689 2673.2248 16.5 1 2 0.9 +1Score > 38 indicates identity
Score > 14 indicates homology		 SSWQWPAIFNWLQQTGNVSRHE + 3 Deamidated (NQ)
4291 728.1547 2908.5897 2908.6149 -8.66 1 2 1 +1Score > 32 indicates identity
Score > 14 indicates homology		 AQSAIFMIAIALALAQALWHGWLIRK + Deamidated (NQ); Oxidation (M)
237 312.1863 622.3580 622.3551 4.76 0 2 1 +1Score > 33 indicates identity
Score > 14 indicates homology		 TPHIR
3525 746.4074 2236.2004 2236.2038 -1.52 1 2 1 +1Score > 36 indicates identity
Score > 14 indicates homology		 KLNSAIFPGAQGGPLMHVIAAK + Deamidated (NQ); Oxidation (M)
4423 771.6497 3082.5697 3082.6195 -16.2 0 2 0.68 +1Score > 36 indicates identity
Score > 13 indicates homology		 LNLDIVVAQCAADRPFLGICLGLQALLE + Deamidated (NQ)
2204 769.8981 1537.7816 1537.7572 15.9 1 2 0.91 +1Score > 40 indicates identity
Score > 14 indicates homology		 WPALRCVATDGHR
4507 799.4313 3193.6961 3193.6594 11.5 1 2 1 +1Score > 33 indicates identity
Score > 14 indicates homology		 NTRMALAVVDTFVWQSLASVAIPGFTINR + Deamidated (NQ); Oxidation (M)
4571 662.1714 3305.8206 3305.7821 11.6 1 2 1 +1Score > 29 indicates identity
Score > 14 indicates homology		 HITLRLGALVAPVVSAFSLAFCALPFMGFGK + Oxidation (M)
1237 1085.5488 1084.5415 1084.5512 -8.96 1 2 0.87 +1Score > 40 indicates identity
Score > 14 indicates homology		 AAAALRAQPSE + Deamidated (NQ)
3732 788.4163 2362.2271 2362.1878 16.6 1 2 0.73 +1Score > 37 indicates identity
Score > 13 indicates homology		 NTPFMGPQISIAAAEFILNAQK + 2 Deamidated (NQ)
4630 681.9852 3404.8896 3404.9084 -5.53 1 2 0.81 +1Score > 28 indicates identity
Score > 13 indicates homology		 AWLLFAHQGAEPGHKTLLAALQAEPLLALGLR
4992 924.6274 6465.3409 6465.4571 -18.0 1 2 1 +1Score > 26 indicates identity
Score > 14 indicates homology		 MTNLFSVFDPSTTILNLSLNWLSTFLGLLLIPFSFWLLPNRFQVVWNNILLTLHK + 3 Deamidated (NQ); Oxidation (M)
528 384.7070 767.3994 767.4038 -5.70 0 2 0.98 +1Score > 37 indicates identity
Score > 14 indicates homology		 ADRPGPR
2608 574.3141 1719.9205 1719.9380 -10.2 1 2 0.83 +1Score > 38 indicates identity
Score > 13 indicates homology		 LARVNLPSNTITHQR + Deamidated (NQ)
3642 1154.0648 2306.1150 2306.1504 -15.3 1 2 0.96 +1Score > 39 indicates identity
Score > 14 indicates homology		 LGTNAFAPSAIPFSDTMKIPVE + Deamidated (NQ)
4153 927.4862 2779.4368 2779.3916 16.2 1 2 1 +1Score > 36 indicates identity
Score > 14 indicates homology		 VDAGTQDQLQIDSVFKGSNLFVATPK + 2 Deamidated (NQ)
3581 756.3911 2266.1515 2266.1733 -9.62 1 2 0.92 +1Score > 38 indicates identity
Score > 14 indicates homology		 SSIFIQSGKDFLPSSGLLLQE + Deamidated (NQ)
4134 922.4694 2764.3864 2764.4171 -11.1 1 2 1 +1Score > 37 indicates identity
Score > 14 indicates homology		 DQAFVSSLVPNYGGTLDIIGGVVVESK + Deamidated (NQ)
4221 949.8146 2846.4220 2846.4306 -3.04 1 2 0.81 +1Score > 37 indicates identity
Score > 13 indicates homology		 THCPIYLVNVSSISAGDVIAAAKMQGK + Deamidated (NQ); Oxidation (M)
2978 645.6608 1933.9606 1933.9745 -7.21 1 2 0.95 +1Score > 40 indicates identity
Score > 14 indicates homology		 DGVKNIPSFLSTDNIGTR + Deamidated (NQ)
3757 794.4349 2380.2829 2380.2413 17.5 0 2 0.8 +1Score > 35 indicates identity
Score > 13 indicates homology		 TFQSPGVILSYLQNVSLSLPSK + 3 Deamidated (NQ)
4408 1023.5590 3067.6552 3067.6459 3.03 1 2 1 +1Score > 32 indicates identity
Score > 14 indicates homology		 AMMGVLGITCGVMVWAGVALLGLHLIIEK + Oxidation (M)
873 920.4786 919.4713 919.4651 6.78 0 2 1 +1Score > 42 indicates identity
Score > 14 indicates homology		 QPIATIYD
3784 805.0856 2412.2350 2412.1995 14.7 1 2 0.9 +1Score > 38 indicates identity
Score > 14 indicates homology		 QCFVSILNIIQGEVDPSQVHK + 2 Deamidated (NQ)
4726 617.8303 3700.9381 3700.8829 14.9 1 2 0.96 +1Score > 32 indicates identity
Score > 14 indicates homology		 LQNTTILLKTLNANTSQVCNSVIQGNGLSVQQLE + 3 Deamidated (NQ)
3415 728.7286 2183.1640 2183.1409 10.6 1 2 0.95 +1Score > 37 indicates identity
Score > 14 indicates homology		 MYALQFQSVVPRTLVSSNK + Oxidation (M)
3662 463.8562 2314.2446 2314.2130 13.7 1 2 0.9 +1Score > 35 indicates identity
Score > 14 indicates homology		 MVVANPILVQADIDFLLGELE + Oxidation (M)
3684 777.4471 2329.3195 2329.3481 -12.3 1 2 0.75 +1Score > 30 indicates identity
Score > 13 indicates homology		 IQLAARIIAAVPNPADVVAISAR + Deamidated (NQ)
3959 643.0664 2568.2365 2568.2119 9.59 1 2 0.77 +1Score > 38 indicates identity
Score > 13 indicates homology		 AQSLNVQILTEDLWLQYTQSSE + 3 Deamidated (NQ)
4612 843.7024 3370.7805 3370.7152 19.4 1 2 0.7 +1Score > 33 indicates identity
Score > 13 indicates homology		 AIMGDLQSLGLKSGINAMLIGHYLTTLGQPPE + Deamidated (NQ); 2 Oxidation (M)
3226 1048.5619 2095.1092 2095.0844 11.9 1 2 0.74 +1Score > 37 indicates identity
Score > 13 indicates homology		 AQVAQIAGKPSSEVSMIHAR + Oxidation (M)
3583 1136.5863 2271.1580 2271.1509 3.16 1 2 1 +1Score > 38 indicates identity
Score > 14 indicates homology		 GDVVVAVHADHHTKGFANQIR + Deamidated (NQ)
3849 822.4490 2464.3252 2464.3433 -7.36 1 2 1 +1Score > 35 indicates identity
Score > 14 indicates homology		 MIPIPRVTDVNKPPLSLIMDAK + Deamidated (NQ); Oxidation (M)
519 765.4022 764.3949 764.3851 12.9 1 2 0.82 +1Score > 42 indicates identity
Score > 13 indicates homology		 MTKVDR + Oxidation (M)
3806 808.4595 2422.3567 2422.3835 -11.1 1 2 1 +1Score > 31 indicates identity
Score > 14 indicates homology		 TKPVFVVATANNVDLLPLEIIR + Deamidated (NQ)
3819 609.8371 2435.3193 2435.3392 -8.19 1 2 0.89 +1Score > 35 indicates identity
Score > 14 indicates homology		 DALIGMDLVIIPAGVPRKPGMTR + Oxidation (M)
3860 495.0926 2470.4266 2470.4484 -8.83 1 2 0.95 +1Score > 26 indicates identity
Score > 14 indicates homology		 ILGLLAAMLPPIKSGPTVPLIDLE
3975 862.4528 2584.3366 2584.3068 11.5 1 2 1 +1Score > 37 indicates identity
Score > 14 indicates homology		 VSVNSQTGQKGLSWSIPMAQTPPR + Oxidation (M)
4493 636.7300 3178.6136 3178.5645 15.5 1 2 0.94 +1Score > 35 indicates identity
Score > 14 indicates homology		 YSGAMVSDIHRILVQGGVFLYPGTIQNPE + 2 Deamidated (NQ); Oxidation (M)
3042 660.7468 1979.2186 1979.1931 12.9 1 2 3.2 +1Score > 19 indicates identity LLKHYLQSGIVVLINIR + Deamidated (NQ)
3755 794.1158 2379.3256 2379.3083 7.24 0 2 1 +1Score > 32 indicates identity
Score > 14 indicates homology		 NAMVPLVSGIPAAIIGVIGGATLTE + Oxidation (M)
4248 720.1620 2876.6189 2876.6700 -17.8 1 2 1 +1Score > 29 indicates identity
Score > 14 indicates homology		 YQTVASLKYLLLLILIPVLVNQMSK + Deamidated (NQ); Oxidation (M)
3607 762.1027 2283.2863 2283.3024 -7.08 1 2 0.81 +1Score > 31 indicates identity
Score > 13 indicates homology		 IILADPNVKAILVNIFGGIMR + Deamidated (NQ); Oxidation (M)
4307 976.8347 2927.4823 2927.4885 -2.12 0 2 1 +1Score > 37 indicates identity
Score > 14 indicates homology		 LVQSHEPVSVQMYSSMLNLLGRPTLE
3907 838.4335 2512.2787 2512.2486 12.0 1 2 0.8 +1Score > 38 indicates identity
Score > 13 indicates homology		 LANQITITFAPGDPQKVFIDGHE + 2 Deamidated (NQ)
1618 416.2621 1245.7645 1245.7670 -1.99 1 2 0.77 +1Score > 28 indicates identity
Score > 13 indicates homology		 AIHTRLLPAVR
3548 1124.6353 2247.2560 2247.2263 13.2 0 2 1 +1Score > 32 indicates identity
Score > 14 indicates homology		 WGIGSGISLFIAAGVSQTILTR + Deamidated (NQ)
2862 623.3422 1867.0048 1866.9986 3.33 1 2 1 +1Score > 37 indicates identity
Score > 14 indicates homology		 VADVAGVPLLASMRAQPR + Deamidated (NQ); Oxidation (M)
3969 861.1351 2580.3835 2580.3444 15.1 0 2 1 +1Score > 34 indicates identity
Score > 14 indicates homology		 MPFLQISLLSIGVAADAFACSVVR + Oxidation (M)
4250 961.1349 2880.3829 2880.3409 14.6 1 2 0.82 +1Score > 37 indicates identity
Score > 13 indicates homology		 HMDQLQQNVSIVTQQKMQPIYSVK + 6 Deamidated (NQ); 2 Oxidation (M)
4720 921.0038 3679.9861 3680.0124 -7.14 1 2 1 +1Score > 30 indicates identity
Score > 14 indicates homology		 LGFPKGLAVQGMISQLIQSGGISINILSGDIHLFR + Deamidated (NQ)
4538 1080.9310 3239.7712 3239.7754 -1.30 1 2 0.84 +1Score > 30 indicates identity
Score > 13 indicates homology		 LACVGAIARGFAHLWLQAATLGFVGSVVLSR
1228 1078.5851 1077.5778 1077.5706 6.70 1 2 0.83 +1Score > 41 indicates identity
Score > 13 indicates homology		 KISGFIGNIE + Deamidated (NQ)
4916 1190.1097 4756.4097 4756.4220 -2.58 0 2 1 +1Score > 30 indicates identity
Score > 14 indicates homology		 VIIVIGGDGALLHNIHCYMHLNIPFYGVNLGSLGFLMNTLDTK + Deamidated (NQ); Oxidation (M)
Page: Previous 1 …22 23 24 25 26 27 28 29 30 31 32 … 39 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/