MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita5 sp
MS data file : PRT1270_T-BRSC_5_20250714121805.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 23:42:02 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,997

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 2501–2600 (out of 3818)

Page: Previous 1 …21 22 23 24 25 26 27 28 29 30 31 … 39 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
1679 640.8886 1279.7626 1279.7434 15.0 1 3 0.95 +1Score > 33 indicates identity
Score > 15 indicates homology		 LISVMPHLSRK
3372 1083.5759 2165.1372 2165.1038 15.4 0 3 0.59 +1Score > 37 indicates identity
Score > 13 indicates homology		 GLALINGTQAMTSQGVISYIE
3926 846.7971 2537.3695 2537.3213 19.0 0 3 0.85 +1Score > 34 indicates identity
Score > 14 indicates homology		 WQSIPSKPGMGLSVIHQADAIFR
4253 961.8219 2882.4439 2882.4670 -8.02 1 3 0.79 +1Score > 37 indicates identity
Score > 14 indicates homology		 GNRPSNMLLMENLTPHVLGALIALYE + Deamidated (NQ); Oxidation (M)
2974 644.6985 1931.0737 1931.0564 8.97 1 3 1 +1Score > 34 indicates identity
Score > 15 indicates homology		 WRSVVSIPHGPSIMLPR
3113 677.3666 2029.0780 2029.0700 3.92 0 3 0.83 +1Score > 38 indicates identity
Score > 14 indicates homology		 MDPVMGIIAVALGGAVGSLAR + 2 Oxidation (M)
3645 770.0959 2307.2659 2307.2621 1.64 1 3 1 +1Score > 34 indicates identity
Score > 15 indicates homology		 VLMVGVGDDVQVGRPLVEGAAVK
3914 841.4610 2521.3612 2521.3388 8.88 1 3 1 +1Score > 34 indicates identity
Score > 15 indicates homology		 DAINRQLDNGAIVLIGPVAVSVTGE + Deamidated (NQ)
3555 1126.5880 2251.1614 2251.1345 12.0 1 3 0.99 +1Score > 38 indicates identity
Score > 15 indicates homology		 AVNGGVGFAKTAGNYAASLQAQR + Deamidated (NQ)
3586 758.4079 2272.2019 2272.1658 15.9 1 3 1 +1Score > 37 indicates identity
Score > 15 indicates homology		 LSRSNIATLADADALASIAQDR + Deamidated (NQ)
4882 1115.5770 4458.2789 4458.2588 4.51 1 3 1 +1Score > 31 indicates identity
Score > 15 indicates homology		 IISDTTDPNTQLALVENATAMQNNINAILGTNVSIPFLSATR + Deamidated (NQ); Oxidation (M)
3079 1004.5876 2007.1606 2007.1364 12.1 1 3 1 +1Score > 29 indicates identity
Score > 15 indicates homology		 DDLLIQALTVAVQVPQRK + Deamidated (NQ)
4185 702.8944 2807.5485 2807.5329 5.56 1 3 0.87 +1Score > 31 indicates identity
Score > 14 indicates homology		 MMLEHVLVLSAYLLSIGIYGLITSR + Oxidation (M)
4795 797.6263 3983.0951 3983.1489 -13.5 1 3 0.77 +1Score > 31 indicates identity
Score > 14 indicates homology		 AGATLIGPNCPGIISPGKTHLGIMPVQIFKPGNVGIVSR + Deamidated (NQ); Oxidation (M)
4831 813.4388 4062.1576 4062.1573 0.071 1 3 1 +1Score > 30 indicates identity
Score > 15 indicates homology		 HQLGTAYGFMQSIQNLGLAVIAILAGMILDSKGYLLLE + Deamidated (NQ)
4283 969.4855 2905.4347 2905.4686 -11.7 1 3 0.7 +1Score > 37 indicates identity
Score > 14 indicates homology		 ITPGMLMAAMRINIPTIFVSGGPMAAGR + Deamidated (NQ); 2 Oxidation (M)
4322 986.5397 2956.5973 2956.5546 14.4 1 3 0.7 +1Score > 32 indicates identity
Score > 13 indicates homology		 LVEYGPIQAQVHPGLATLLTGPAGQKPQA + 3 Deamidated (NQ)
4572 827.4675 3305.8409 3305.8268 4.25 1 3 0.61 +1Score > 29 indicates identity
Score > 13 indicates homology		 GLDSLLSIVQMPAGVPVATVSIGGAKNAGLLAIR + 2 Deamidated (NQ); Oxidation (M)
3690 779.3915 2335.1527 2335.1254 11.7 1 3 0.8 +1Score > 39 indicates identity
Score > 14 indicates homology		 SLSQTFLGGGLDVDMVKVEPNE + Deamidated (NQ)
3949 641.0666 2560.2373 2560.2012 14.1 0 3 1 +1Score > 38 indicates identity
Score > 15 indicates homology		 DMPFMPDGTPIDIMLNPLGVPSR + 3 Oxidation (M)
4682 891.4611 3561.8153 3561.8629 -13.4 1 3 0.64 +1Score > 34 indicates identity
Score > 13 indicates homology		 NVDMLKGLNFVAIISLMGWGLGYFGQPHILAR + 2 Oxidation (M)
3303 712.0653 2133.1741 2133.1317 19.9 1 2 0.84 +1Score > 35 indicates identity
Score > 14 indicates homology		 AGFISSNQLVKVLGNGALTNK + 3 Deamidated (NQ)
3371 722.6943 2165.0611 2165.0833 -10.3 1 2 0.9 +1Score > 39 indicates identity
Score > 15 indicates homology		 GLVKDFADLYAVPFPAWQE
3544 562.0587 2244.2057 2244.1638 18.7 1 2 0.84 +1Score > 36 indicates identity
Score > 14 indicates homology		 DGPATPKTLQQSYIIADLADK
3767 797.1458 2388.4156 2388.4041 4.81 0 2 1 +1Score > 24 indicates identity
Score > 15 indicates homology		 ITIPLAVLIVICFMLAAVFIR + Oxidation (M)
3164 1029.5049 2056.9952 2057.0114 -7.86 1 2 0.77 +1Score > 39 indicates identity
Score > 14 indicates homology		 WKIYTNTMAMPPQYIGK + Oxidation (M)
4303 732.3909 2925.5345 2925.5239 3.63 0 2 0.59 +1Score > 35 indicates identity
Score > 13 indicates homology		 AMQVAGAVTPVPGGVGQMTVACLLVNTLR + Oxidation (M)
2519 557.5903 1669.7491 1669.7624 -7.98 0 2 0.94 +1Score > 39 indicates identity
Score > 15 indicates homology		 AGFPSPNIQPIDFHE + 2 Deamidated (NQ)
3127 1019.5251 2037.0356 2037.0378 -1.05 1 2 0.98 +1Score > 39 indicates identity
Score > 15 indicates homology		 NKGQDAAIALGHSLVNGQIK + 4 Deamidated (NQ)
3970 861.1465 2580.4177 2580.4057 4.63 1 2 1 +1Score > 32 indicates identity
Score > 15 indicates homology		 AATQVLLDRLQQNALVQSVMRPK + 2 Deamidated (NQ)
4782 781.2122 3901.0246 3900.9574 17.2 0 2 1 +1Score > 33 indicates identity
Score > 15 indicates homology		 QVVQFVLADASSAGGPHVAFANGVFVDASLPLKPSFQE + 2 Deamidated (NQ)
3741 475.4757 2372.3421 2372.3355 2.78 0 2 0.97 +1Score > 31 indicates identity
Score > 15 indicates homology		 IAAFQALDLDAAVVVAFGQILVK + Deamidated (NQ)
3566 753.7170 2258.1292 2258.1300 -0.36 1 2 0.97 +1Score > 39 indicates identity
Score > 15 indicates homology		 LYIMHLISSNTPKSHCSVR + Oxidation (M)
3062 664.3516 1990.0330 1990.0193 6.85 1 2 0.78 +1Score > 39 indicates identity
Score > 14 indicates homology		 SINVQNISMDLPIFDKR + Deamidated (NQ)
4710 731.5820 3652.8736 3652.8472 7.23 0 2 0.71 +1Score > 34 indicates identity
Score > 13 indicates homology		 DAAAAFATTLPVVSTGQIATATPGQPDATSAPAAIASIE
3619 766.7421 2297.2045 2297.2276 -10.1 0 2 0.86 +1Score > 37 indicates identity
Score > 14 indicates homology		 SGMFLTLFVNTLLNIVIACR + Oxidation (M)
4124 689.6190 2754.4469 2754.4449 0.74 0 2 1 +1Score > 35 indicates identity
Score > 15 indicates homology		 GTYLVTVILLVSTLSVGMCSNGWIR + Oxidation (M)
4224 951.1423 2850.4051 2850.3779 9.53 1 2 1 +1Score > 37 indicates identity
Score > 15 indicates homology		 VVDASIMPHLVAGNTNAPTIMIAENAAE + 2 Deamidated (NQ)
4105 911.7933 2732.3581 2732.3340 8.80 0 2 1 +1Score > 37 indicates identity
Score > 15 indicates homology		 LISAQPTHHPPQSPAQLQMQLQHE + Deamidated (NQ); Oxidation (M)
1524 607.3344 1212.6542 1212.6462 6.60 1 2 0.93 +1Score > 40 indicates identity
Score > 15 indicates homology		 KPRTAPLGSTGE
3299 711.7208 2132.1406 2132.1299 4.98 1 2 0.85 +1Score > 36 indicates identity
Score > 14 indicates homology		 MSISPNVGALPKYLASNVVR + Deamidated (NQ); Oxidation (M)
3738 790.3981 2368.1725 2368.1634 3.82 0 2 1 +1Score > 39 indicates identity
Score > 15 indicates homology		 VFSTKPVPGFPQGCLGASQPHR + 2 Deamidated (NQ)
4255 962.8112 2885.4118 2885.4350 -8.04 1 2 0.83 +1Score > 37 indicates identity
Score > 14 indicates homology		 KFVNIWIIDMIDTSILGFSNFPWE + Deamidated (NQ)
3502 741.6858 2222.0356 2222.0195 7.25 1 2 1 +1Score > 39 indicates identity
Score > 15 indicates homology		 TISVSDLPNNCLNASSLKCE + Deamidated (NQ)
3370 1083.5332 2165.0518 2165.0099 19.4 0 2 0.93 +1Score > 39 indicates identity
Score > 15 indicates homology		 QVQHPQAVLDAMAFYSQSK + 2 Deamidated (NQ); Oxidation (M)
4741 749.6136 3743.0316 3743.0087 6.14 1 2 0.75 +1Score > 29 indicates identity
Score > 14 indicates homology		 SLLWHALTPQFFPVSILRTHLSAALAAQVPITDE + Deamidated (NQ)
4210 946.1526 2835.4360 2835.4324 1.27 1 2 0.87 +1Score > 37 indicates identity
Score > 14 indicates homology		 QSLMLQPISYINGTINLPGSKSVSNR + 3 Deamidated (NQ); Oxidation (M)
2727 596.6606 1786.9600 1786.9499 5.66 1 2 0.87 +1Score > 38 indicates identity
Score > 14 indicates homology		 ADILVAAVGRLQMITAE + Deamidated (NQ); Oxidation (M)
3252 705.3932 2113.1578 2113.1194 18.1 1 2 0.86 +1Score > 35 indicates identity
Score > 14 indicates homology		 ASLTILPSQDGEAFPLVLLE + Deamidated (NQ)
3369 722.4155 2164.2247 2164.1852 18.3 1 2 1 +1Score > 31 indicates identity
Score > 15 indicates homology		 DTSIVLDTQLSHRLLPSLR + Deamidated (NQ)
4480 790.4259 3157.6745 3157.6772 -0.85 0 2 0.61 +1Score > 33 indicates identity
Score > 13 indicates homology		 LIVSSVASVSQAAGPDVPATSHPLPLQNVFR + Deamidated (NQ)
4425 772.4272 3085.6797 3085.6594 6.57 1 2 0.74 +1Score > 31 indicates identity
Score > 14 indicates homology		 TLVGAMAATGLGLQGKTVHSITINDYLAVR + Oxidation (M)
4286 970.4874 2908.4404 2908.4133 9.32 1 2 1 +1Score > 37 indicates identity
Score > 15 indicates homology		 VQKNQLMQLPTAADNAPMIMNSIFGK + Deamidated (NQ); 3 Oxidation (M)
4598 836.4302 3341.6917 3341.6483 13.0 1 2 1 +1Score > 35 indicates identity
Score > 15 indicates homology		 CQDALNILPVPGPTSSATNVSMVVSAGPLSSEK + Oxidation (M)
2297 790.4373 1578.8600 1578.8365 14.9 1 2 1 +1Score > 38 indicates identity
Score > 15 indicates homology		 VLAENDVAAITLHGR + Deamidated (NQ)
3504 743.3986 2227.1740 2227.1936 -8.79 1 2 1 +1Score > 37 indicates identity
Score > 15 indicates homology		 RSGLFSSLCLPIYSLLHHK
3920 842.4543 2524.3411 2524.3584 -6.87 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 AIVTGHATIAGNPLVIAVMDSRFR + Oxidation (M)
2771 905.9988 1809.9830 1809.9724 5.90 1 2 0.74 +1Score > 37 indicates identity
Score > 13 indicates homology		 DPAIRNVIVLQTVLQE + 3 Deamidated (NQ)
3687 779.0609 2334.1609 2334.1963 -15.2 1 2 1 +1Score > 39 indicates identity
Score > 15 indicates homology		 KNMAKPNSLLMPINTFSGIIQ + 2 Deamidated (NQ); Oxidation (M)
4045 892.0980 2673.2722 2673.2439 10.6 1 2 0.82 +1Score > 38 indicates identity
Score > 14 indicates homology		 SVNAGGRAVAVDDNVPQDVLMDAVNK + 4 Deamidated (NQ); Oxidation (M)
4534 1079.8964 3236.6674 3236.7050 -11.6 0 2 1 +1Score > 35 indicates identity
Score > 15 indicates homology		 IMSHIAPLGPVYQAGTLSGNPLAMAAGLTTLR + Oxidation (M)
3717 786.7574 2357.2504 2357.2301 8.62 1 2 0.7 +1Score > 36 indicates identity
Score > 13 indicates homology		 LVQIVNKSPEPMIIGSNNLFE + Oxidation (M)
2509 835.4999 1668.9852 1668.9661 11.4 1 2 0.88 +1Score > 31 indicates identity
Score > 14 indicates homology		 LNIILQGNIILSTEK + Deamidated (NQ)
3958 856.4739 2566.3999 2566.3837 6.30 1 2 0.78 +1Score > 33 indicates identity
Score > 14 indicates homology		 MNKPFLILLIALIAFSGCNMRK + Deamidated (NQ); Oxidation (M)
4044 669.3246 2673.2693 2673.2679 0.51 1 2 0.96 +1Score > 38 indicates identity
Score > 15 indicates homology		 VDMVWIVGGSSVYQEAMNQPGHLR + Deamidated (NQ)
4206 943.4922 2827.4548 2827.4711 -5.79 1 2 0.67 +1Score > 36 indicates identity
Score > 13 indicates homology		 VPIICTIIGEGGSGGALGIGIGDSIIMLE + Oxidation (M)
4500 796.3978 3181.5621 3181.5390 7.26 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 EQHNLQTQSSLLYMGTSNGFPFIIQSPK + Deamidated (NQ); Oxidation (M)
4676 709.7630 3543.7786 3543.8316 -15.0 1 2 1 +1Score > 35 indicates identity
Score > 15 indicates homology		 ALPLLMANPPTNMIAQSQSGTGKTAAFVLNILSR + 3 Deamidated (NQ); Oxidation (M)
3699 470.0550 2345.2386 2345.2083 12.9 1 2 0.86 +1Score > 37 indicates identity
Score > 14 indicates homology		 ALPDAISRAAIMMVQSLLNGNK + Deamidated (NQ); 2 Oxidation (M)
4126 689.6215 2754.4569 2754.4449 4.37 0 2 1 +1Score > 35 indicates identity
Score > 15 indicates homology		 GTYLVTVILLVSTLSVGMCSNGWIR + Oxidation (M)
4228 954.5375 2860.5907 2860.6322 -14.5 1 2 1 +1Score > 30 indicates identity
Score > 15 indicates homology		 RFLVLLGIICLALIGGALYMQIVLGE + Oxidation (M)
3270 706.7101 2117.1085 2117.1156 -3.38 1 2 1 +1Score > 38 indicates identity
Score > 15 indicates homology		 IAWAFLKLLGANGNANINSK + 3 Deamidated (NQ)
4470 785.3965 3137.5569 3137.5963 -12.6 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 AFGMVGKLTASGSITMQNIGAMSSYLFIVK + Oxidation (M)
3031 658.6428 1972.9066 1972.8684 19.4 1 2 0.88 +1Score > 39 indicates identity
Score > 14 indicates homology		 QQMQRILDNTSEPQPGE + 3 Deamidated (NQ)
3584 758.3851 2272.1335 2272.1647 -13.8 1 2 0.88 +1Score > 39 indicates identity
Score > 14 indicates homology		 AGSLWRQLFQAGARPCGLGAR + Deamidated (NQ)
4931 1009.5336 5042.6316 5042.5490 16.4 1 2 1 +1Score > 28 indicates identity
Score > 15 indicates homology		 LFLLLITFIALFGAINAFSGVDISQGSSVGDFQCMLNQGFEFAIIR + 3 Deamidated (NQ)
267 637.3574 636.3501 636.3483 2.92 0 2 1 +1Score > 39 indicates identity
Score > 15 indicates homology		 ALSLSF
3683 777.4237 2329.2493 2329.2311 7.80 1 2 0.93 +1Score > 35 indicates identity
Score > 14 indicates homology		 LCANAKGITSQNSNLTIVAILE
4570 551.8096 3304.8139 3304.7998 4.27 0 2 0.91 +1Score > 30 indicates identity
Score > 14 indicates homology		 NNNIINLIAAIILSLSIIFGWQYFVVKPE + 3 Deamidated (NQ)
1443 1176.6322 1175.6249 1175.6220 2.51 1 2 1 +1Score > 41 indicates identity
Score > 15 indicates homology		 TMIRNAVIIE + Deamidated (NQ); Oxidation (M)
2289 315.7945 1573.9361 1573.9191 10.8 1 2 1 +1Score > 30 indicates identity
Score > 15 indicates homology		 ALEPHVQVLAKQIK + Deamidated (NQ)
3309 712.4028 2134.1866 2134.1681 8.66 0 2 1 +1Score > 33 indicates identity
Score > 15 indicates homology		 IISGILHVANTGNVQAVLCR
4870 1092.0632 4364.2237 4364.2482 -5.60 1 2 0.98 +1Score > 31 indicates identity
Score > 15 indicates homology		 FSTGSTPDTKQVTSPSPRPVQPSNAPPPPPPPPPPPPPPPPPK + Deamidated (NQ)
4122 689.6170 2754.4389 2754.4123 9.67 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 LSGARDPIMLYISGGNTQVIAHLNGR + 2 Deamidated (NQ)
4585 1108.6042 3322.7908 3322.7345 16.9 0 2 1 +1Score > 32 indicates identity
Score > 15 indicates homology		 LAWAAGTILLNVAGSLAMTMLAFILVNNFASQ + 2 Deamidated (NQ)
3766 797.1451 2388.4135 2388.4041 3.93 0 2 1 +1Score > 25 indicates identity
Score > 15 indicates homology		 ITIPLAVLIVICFMLAAVFIR + Oxidation (M)
4327 988.7865 2963.3377 2963.3205 5.81 1 2 1 +1Score > 35 indicates identity
Score > 15 indicates homology		 DKNFGFNAQDMQYVDMIQAGIIDPAK + 3 Deamidated (NQ); 2 Oxidation (M)
4558 820.4207 3277.6537 3277.6037 15.2 0 2 1 +1Score > 35 indicates identity
Score > 15 indicates homology		 SHTDKPINAALLTTMPNAFSSQSTAASFPTR + Oxidation (M)
2465 549.6591 1645.9555 1645.9403 9.20 1 2 1 +1Score > 31 indicates identity
Score > 15 indicates homology		 VITDLTGIPTVSKFR
3559 751.4342 2251.2808 2251.2497 13.8 1 2 1 +1Score > 31 indicates identity
Score > 15 indicates homology		 QIMDGLLVANPTTLPISLVKE
3993 653.5674 2610.2405 2610.2496 -3.51 1 2 1 +1Score > 38 indicates identity
Score > 15 indicates homology		 LGLRPMQITVDAAEHDHPGTVHAE + Deamidated (NQ); Oxidation (M)
4525 806.6768 3222.6781 3222.6217 17.5 1 2 1 +1Score > 34 indicates identity
Score > 15 indicates homology		 QVGVVLQDNVLLNRSIIDNIALADPGMPVE + 5 Deamidated (NQ); Oxidation (M)
2866 623.3767 1867.1083 1867.0778 16.3 1 2 1 +1Score > 27 indicates identity
Score > 15 indicates homology		 QLGIQQIKLVINSLGDK + Deamidated (NQ)
3054 663.3513 1987.0321 1987.0415 -4.74 0 2 0.95 +1Score > 39 indicates identity
Score > 14 indicates homology		 YLQTLHFDTLLDGVVPR + Deamidated (NQ)
3999 873.7429 2618.2069 2618.2356 -11.0 1 2 0.65 +1Score > 37 indicates identity
Score > 13 indicates homology		 IIVTNQTTMSQWDVQALMEHVR + 3 Deamidated (NQ); Oxidation (M)
4387 1015.8793 3044.6161 3044.5940 7.26 1 2 0.76 +1Score > 34 indicates identity
Score > 13 indicates homology		 ALIGIVIGGFWSMSAATAMRLVPANDVPR + 2 Oxidation (M)
4709 731.3821 3651.8741 3651.8356 10.6 1 2 1 +1Score > 34 indicates identity
Score > 15 indicates homology		 VMDASVDQLQAVPDVGPIVALSIRTFFDQPHNR + Deamidated (NQ); Oxidation (M)
3955 855.4758 2563.4056 2563.4221 -6.44 1 2 0.67 +1Score > 33 indicates identity
Score > 13 indicates homology		 AGASLAAVVKGLNALGATPADLQTILE
4614 844.4341 3373.7073 3373.7045 0.82 1 2 1 +1Score > 35 indicates identity
Score > 15 indicates homology		 RMSIFALGIMPYISASIIMQLMTAISPQLE + Deamidated (NQ); 3 Oxidation (M)
3403 727.0823 2178.2251 2178.1909 15.7 1 2 1 +1Score > 32 indicates identity
Score > 15 indicates homology		 GVVSAPLNLPGTAYHKALQSR
Page: Previous 1 …21 22 23 24 25 26 27 28 29 30 31 … 39 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/