MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | Rita5 sp |
| MS data file | : | PRT1270_T-BRSC_5_20250714121805.mgf |
| Database | : | SwissProt 57.15 (515,203 sequences; 181,334,896 residues) |
| Timestamp | : | 12 Aug 2025 at 23:42:02 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | GluC_Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,997 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 1438 |
391.8613 | 1172.5621 | 1172.5648 | -2.34 | 1 | 13 | 0.57 | 1Score > 40 indicates identity Score > 23 indicates homology |
HFVEMEPIR + Oxidation (M) |
| 1720 |
651.8613 | 1301.7080 | 1301.7231 | -11.6 | 1 | 13 | 0.69 | 1Score > 40 indicates identity Score > 24 indicates homology |
FKQLSVGPLLAE + Deamidated (NQ) |
| 2426 |
814.9705 | 1627.9264 | 1627.9144 | 7.38 | 1 | 13 | 0.5 | 1Score > 34 indicates identity Score > 23 indicates homology |
LGINASIGIANSKVAAK + 2 Deamidated (NQ) |
| 2722 |
893.4588 | 1784.9030 | 1784.9203 | -9.66 | 0 | 13 | 0.65 | 1Score > 40 indicates identity Score > 24 indicates homology |
IIGSAANAQGICNDILR |
| 2567 |
567.6346 | 1699.8820 | 1699.8628 | 11.3 | 1 | 13 | 0.42 | 1Score > 40 indicates identity Score > 22 indicates homology |
LDEISNDIANVIINR + 2 Deamidated (NQ) |
| 3200 |
1043.5354 | 2085.0562 | 2085.0466 | 4.63 | 1 | 13 | 0.38 | 1Score > 39 indicates identity Score > 21 indicates homology |
YHGLSVGVILNTMHPFER + Oxidation (M) |
| 2387 |
807.4430 | 1612.8714 | 1612.8685 | 1.82 | 1 | 13 | 0.78 | 1Score > 39 indicates identity Score > 25 indicates homology |
QNFLRQTPTLPAAR + Deamidated (NQ) |
| 2755 |
901.9125 | 1801.8104 | 1801.8094 | 0.61 | 1 | 13 | 0.98 | 1Score > 39 indicates identity Score > 26 indicates homology |
NGSSAKWMGPFYIGDR + Deamidated (NQ); Oxidation (M) |
| 3521 |
745.4362 | 2233.2868 | 2233.2583 | 12.8 | 1 | 13 | 0.82 | 1Score > 29 indicates identity Score > 25 indicates homology |
SLTRFGFTLIIGGAIGNLIDR |
| 182 |
586.3887 | 585.3814 | 585.3737 | 13.1 | 0 | 13 | 0.11 | 1Score > 39 indicates identity Score > 16 indicates homology |
ILDIL |
| 3040 |
990.5219 | 1979.0292 | 1979.0372 | -4.04 | 1 | 13 | 0.57 | 1Score > 39 indicates identity Score > 23 indicates homology |
FLKCLGPNLIFDMGLNK |
| 1463 |
593.3240 | 1184.6334 | 1184.6288 | 3.90 | 0 | 13 | 0.94 | 1Score > 40 indicates identity Score > 25 indicates homology |
QLNASISLIPE + Deamidated (NQ) |
| 2528 |
837.4741 | 1672.9336 | 1672.9070 | 16.0 | 1 | 13 | 0.7 | 1Score > 36 indicates identity Score > 24 indicates homology |
EKPTILLMVGVQGSGK + Deamidated (NQ); Oxidation (M) |
| 556 |
390.2287 | 778.4428 | 778.4337 | 11.7 | 1 | 13 | 0.66 | 1Score > 37 indicates identity Score > 24 indicates homology |
FGAKATGK |
| 1782 |
666.3823 | 1330.7500 | 1330.7344 | 11.8 | 1 | 13 | 0.43 | 1Score > 38 indicates identity Score > 22 indicates homology |
TTVQIKGDLLDK + Deamidated (NQ) |
| 2163 |
758.3707 | 1514.7268 | 1514.7293 | -1.63 | 1 | 13 | 0.54 | 1Score > 40 indicates identity Score > 23 indicates homology |
VFSVFALFENDVE |
| 257 |
316.1874 | 630.3602 | 630.3701 | -15.6 | 0 | 13 | 0.86 | 1Score > 44 indicates identity Score > 25 indicates homology |
NVGTLK |
| 1361 |
571.8622 | 1141.7098 | 1141.7070 | 2.45 | 0 | 13 | 0.99 | 1Score > 30 indicates identity Score > 26 indicates homology |
ISIQVLQTLK |
| 1545 |
407.8766 | 1220.6080 | 1220.6183 | -8.46 | 1 | 13 | 0.97 | 1Score > 42 indicates identity Score > 25 indicates homology |
MNGTTNGLRIK + Deamidated (NQ); Oxidation (M) |
| 4361 |
1004.8807 | 3011.6203 | 3011.5750 | 15.0 | 1 | 13 | 0.23 | 1Score > 33 indicates identity Score > 19 indicates homology |
LLNQGGLFVLTGASAALNRTSGMIAYGATK + Deamidated (NQ); Oxidation (M) |
| 2634 |
866.8906 | 1731.7666 | 1731.7807 | -8.14 | 0 | 13 | 0.69 | 1Score > 39 indicates identity Score > 24 indicates homology |
NDNPLVDMQAMSPTAK + Deamidated (NQ) |
| 3013 |
983.5123 | 1965.0100 | 1964.9990 | 5.64 | 1 | 13 | 0.83 | 1Score > 39 indicates identity Score > 25 indicates homology |
AGARAGMVAVDQTTIDYVK |
| 1474 |
594.8229 | 1187.6312 | 1187.6397 | -7.14 | 1 | 13 | 0.71 | 1Score > 41 indicates identity Score > 24 indicates homology |
LAEALTISQNK + Deamidated (NQ) |
| 1646 |
633.3059 | 1264.5972 | 1264.5969 | 0.28 | 1 | 13 | 0.84 | 1Score > 41 indicates identity Score > 25 indicates homology |
LQAVSAGSMQKE + Deamidated (NQ); Oxidation (M) |
| 413 |
356.7227 | 711.4308 | 711.4391 | -11.6 | 1 | 13 | 0.62 | 1Score > 35 indicates identity Score > 23 indicates homology |
ARAGLPK |
| 646 |
413.2535 | 824.4924 | 824.4980 | -6.79 | 1 | 13 | 0.51 | 1Score > 33 indicates identity Score > 23 indicates homology |
NPGRLLR |
| 1062 |
332.8551 | 995.5435 | 995.5440 | -0.54 | 1 | 13 | 0.79 | 1Score > 37 indicates identity Score > 24 indicates homology |
WTYKTGLK |
| 2306 |
791.3866 | 1580.7586 | 1580.7769 | -11.6 | 1 | 13 | 0.5 | 1Score > 41 indicates identity Score > 22 indicates homology |
QDIQKLFSTWCR |
| 2627 |
576.9916 | 1727.9530 | 1727.9206 | 18.7 | 1 | 13 | 0.32 | 1Score > 37 indicates identity Score > 21 indicates homology |
FNTLHQLLRTLQDK + 2 Deamidated (NQ) |
| 2772 |
906.0349 | 1810.0552 | 1810.0703 | -8.31 | 1 | 13 | 0.71 | 1Score > 30 indicates identity Score > 24 indicates homology |
VLTKNVILDNILLVLE + 2 Deamidated (NQ) |
| 2503 |
556.9893 | 1667.9461 | 1667.9359 | 6.12 | 1 | 13 | 0.56 | 1Score > 34 indicates identity Score > 23 indicates homology |
WQGANLNVPIITSKK |
| 1352 |
570.2644 | 1138.5142 | 1138.5117 | 2.21 | 1 | 13 | 0.51 | 1Score > 40 indicates identity Score > 23 indicates homology |
FSAMGVWNEV |
| 558 |
391.2098 | 780.4050 | 780.4018 | 4.19 | 0 | 13 | 0.64 | 1Score > 40 indicates identity Score > 23 indicates homology |
FTKPTST |
| 3010 |
653.6857 | 1958.0353 | 1958.0109 | 12.5 | 1 | 13 | 0.69 | 1Score > 38 indicates identity Score > 24 indicates homology |
FLNLTSDQVAHLIKSDR + 2 Deamidated (NQ) |
| 2904 |
944.5114 | 1887.0082 | 1886.9738 | 18.3 | 0 | 13 | 0.99 | 1Score > 38 indicates identity Score > 25 indicates homology |
AGDVLTFPGTPNTAAVISR + Deamidated (NQ) |
| 2130 |
751.8527 | 1501.6908 | 1501.6896 | 0.82 | 1 | 13 | 0.33 | 1Score > 40 indicates identity Score > 21 indicates homology |
SAADGTSVPENGTAPK + Deamidated (NQ) |
| 1019 |
487.3132 | 972.6118 | 972.5968 | 15.5 | 1 | 13 | 0.43 | 1Score > 30 indicates identity Score > 22 indicates homology |
ILKTGISNK |
| 2905 |
630.0103 | 1887.0091 | 1887.0214 | -6.54 | 1 | 13 | 0.53 | 1Score > 38 indicates identity Score > 23 indicates homology |
ATAGNLATAGGPRFGLVVSK + Deamidated (NQ) |
| 2981 |
484.5196 | 1934.0493 | 1934.0295 | 10.2 | 1 | 13 | 0.54 | 1Score > 37 indicates identity Score > 23 indicates homology |
INLNASAKDMFVLDIVR + Oxidation (M) |
| 3848 |
822.1150 | 2463.3232 | 2463.3009 | 9.04 | 0 | 13 | 0.13 | 1Score > 35 indicates identity Score > 16 indicates homology |
IAVAHYAAQLSTLDINPQPLSLE |
| 1529 |
405.8922 | 1214.6548 | 1214.6619 | -5.85 | 1 | 13 | 0.57 | 1Score > 41 indicates identity Score > 23 indicates homology |
LIQDSGLQGKR + Deamidated (NQ) |
| 1686 |
644.3719 | 1286.7292 | 1286.7194 | 7.65 | 1 | 13 | 0.78 | 1Score > 38 indicates identity Score > 24 indicates homology |
DRVAASVDLITK |
| 2903 |
630.0098 | 1887.0076 | 1887.0102 | -1.37 | 1 | 13 | 0.64 | 1Score > 38 indicates identity Score > 23 indicates homology |
FGRLVQLQTLILQDNE + Deamidated (NQ) |
| 800 |
446.7444 | 891.4742 | 891.4702 | 4.58 | 1 | 13 | 0.57 | 1Score > 41 indicates identity Score > 23 indicates homology |
VAEFIADK |
| 1683 |
642.8714 | 1283.7282 | 1283.7085 | 15.4 | 1 | 13 | 0.25 | 1Score > 38 indicates identity Score > 19 indicates homology |
VTTAPKNGLGPTK + Deamidated (NQ) |
| 2857 |
933.9279 | 1865.8412 | 1865.8499 | -4.64 | 0 | 13 | 0.75 | 1Score > 39 indicates identity Score > 24 indicates homology |
LDLMDQGTNAMDILSGR + Deamidated (NQ); Oxidation (M) |
| 1060 |
332.8548 | 995.5426 | 995.5261 | 16.6 | 1 | 13 | 0.67 | 1Score > 37 indicates identity Score > 24 indicates homology |
DARHAATVR |
| 2601 |
573.3117 | 1716.9133 | 1716.8934 | 11.6 | 1 | 13 | 0.42 | 1Score > 39 indicates identity Score > 21 indicates homology |
AGVYQGIVSPKQLLDE + Deamidated (NQ) |
| 3526 |
746.4114 | 2236.2124 | 2236.2038 | 3.83 | 1 | 13 | 1 | 1Score > 35 indicates identity Score > 25 indicates homology |
KVNSAVFPGLQGGPLMHVIAGK + Deamidated (NQ); Oxidation (M) |
| 2595 |
857.4455 | 1712.8764 | 1712.8621 | 8.37 | 0 | 13 | 0.62 | 1Score > 40 indicates identity Score > 23 indicates homology |
GQLDPIFIASPDQLAE |
| 2958 |
641.6874 | 1922.0404 | 1922.0338 | 3.44 | 1 | 13 | 0.65 | 1Score > 36 indicates identity Score > 23 indicates homology |
MTRCALLLLMVLMLGR + 2 Oxidation (M) |
| 3262 |
1059.0416 | 2116.0686 | 2116.0834 | -6.97 | 0 | 13 | 0.71 | 1Score > 39 indicates identity Score > 24 indicates homology |
DIATQLISNMDINVILGGGR + Deamidated (NQ); Oxidation (M) |
| 284 |
323.7008 | 645.3870 | 645.3850 | 3.21 | 0 | 13 | 0.95 | 1Score > 39 indicates identity Score > 25 indicates homology |
FAPAIK |
| 3281 |
708.0713 | 2121.1921 | 2121.1649 | 12.8 | 0 | 13 | 0.16 | 1Score > 32 indicates identity Score > 17 indicates homology |
IDFIQVIIYIGFPNLLIE + 2 Deamidated (NQ) |
| 2653 |
582.2906 | 1743.8500 | 1743.8639 | -7.96 | 1 | 13 | 0.86 | 1Score > 40 indicates identity Score > 25 indicates homology |
VTKNSIAPVSSNPSANR + 3 Deamidated (NQ) |
| 2861 |
623.3422 | 1867.0048 | 1866.9774 | 14.7 | 1 | 13 | 0.46 | 1Score > 37 indicates identity Score > 22 indicates homology |
RDIVVWGAMIAGLAHNK + Deamidated (NQ); Oxidation (M) |
| 120 |
474.2688 | 473.2615 | 473.2598 | 3.68 | 0 | 13 | 0.69 | 1Score > 47 indicates identity Score > 24 indicates homology |
AAAGGK |
| 355 |
343.7146 | 685.4146 | 685.4123 | 3.46 | 0 | 13 | 0.6 | 1Score > 42 indicates identity Score > 23 indicates homology |
NGIGVVK |
| 4436 |
1034.2181 | 3099.6325 | 3099.5733 | 19.1 | 1 | 13 | 0.1 | 1Score > 33 indicates identity Score > 15 indicates homology |
AMLSTWLATSPVGATDIIAPAQQALAMARE + Oxidation (M) |
| 472 |
368.2254 | 734.4362 | 734.4439 | -10.4 | 1 | 13 | 0.37 | 1Score > 36 indicates identity Score > 21 indicates homology |
LTFKAR |
| 1405 |
580.3619 | 1158.7092 | 1158.7046 | 4.02 | 1 | 13 | 0.26 | 1Score > 31 indicates identity Score > 19 indicates homology |
SLPLLMITKK + Oxidation (M) |
| 3360 |
1078.1045 | 2154.1944 | 2154.1546 | 18.5 | 1 | 13 | 0.4 | 1Score > 33 indicates identity Score > 21 indicates homology |
QGQDIAGVVRPFDDRLVLR + Deamidated (NQ) |
| 2132 |
751.9054 | 1501.7962 | 1501.8062 | -6.59 | 1 | 13 | 0.57 | 1Score > 40 indicates identity Score > 23 indicates homology |
IKSMIDAAIPVLSE + Oxidation (M) |
| 1855 |
684.3652 | 1366.7158 | 1366.7092 | 4.85 | 1 | 13 | 0.35 | 1Score > 39 indicates identity Score > 21 indicates homology |
LASKTDINYNTK |
| 2022 |
724.3587 | 1446.7028 | 1446.7296 | -18.5 | 0 | 13 | 0.94 | 1Score > 41 indicates identity Score > 25 indicates homology |
LWYPLWDANIR + Deamidated (NQ) |
| 3169 |
687.0266 | 2058.0580 | 2058.0593 | -0.66 | 1 | 13 | 0.83 | 1Score > 39 indicates identity Score > 24 indicates homology |
VDQTGTILIKNGTVVNDDR + Deamidated (NQ) |
| 1007 |
324.8403 | 971.4991 | 971.5036 | -4.65 | 1 | 12 | 0.82 | 1Score > 41 indicates identity Score > 24 indicates homology |
QVLQGAEAR + Deamidated (NQ) |
| 2281 |
786.4404 | 1570.8662 | 1570.8541 | 7.73 | 0 | 12 | 0.5 | 1Score > 38 indicates identity Score > 22 indicates homology |
LAGILVNDWMAVIR + Deamidated (NQ) |
| 2939 |
638.9922 | 1913.9548 | 1913.9418 | 6.79 | 1 | 12 | 0.51 | 1Score > 40 indicates identity Score > 22 indicates homology |
NWLMQGVAAQGDRVQLE |
| 3516 |
1116.5934 | 2231.1722 | 2231.1296 | 19.1 | 1 | 12 | 0.38 | 1Score > 37 indicates identity Score > 21 indicates homology |
ELQWLLNMIQTDPVPYVR + Deamidated (NQ); Oxidation (M) |
| 3396 |
1089.5287 | 2177.0428 | 2177.0211 | 9.97 | 1 | 12 | 0.42 | 1Score > 39 indicates identity Score > 21 indicates homology |
DQITVWGFHSDNKIQMNK + Deamidated (NQ); Oxidation (M) |
| 1733 |
655.3308 | 1308.6470 | 1308.6422 | 3.71 | 1 | 12 | 0.57 | 1Score > 41 indicates identity Score > 22 indicates homology |
KSANNAHQVPDK + Deamidated (NQ) |
| 2430 |
816.4136 | 1630.8126 | 1630.8355 | -14.0 | 1 | 12 | 0.34 | 1Score > 41 indicates identity Score > 20 indicates homology |
YFTPALTTVHQPKE |
| 766 |
875.4810 | 874.4737 | 874.4872 | -15.4 | 1 | 12 | 0.31 | 1Score > 41 indicates identity Score > 20 indicates homology |
KVNTTANK |
| 2365 |
536.9349 | 1607.7829 | 1607.7652 | 11.0 | 1 | 12 | 0.63 | 1Score > 41 indicates identity Score > 23 indicates homology |
TRGSPHINPTDANAR + 2 Deamidated (NQ) |
| 1701 |
647.3380 | 1292.6614 | 1292.6435 | 13.9 | 0 | 12 | 0.34 | 1Score > 41 indicates identity Score > 20 indicates homology |
FVVNNMVNVLE + Oxidation (M) |
| 1475 |
594.8271 | 1187.6396 | 1187.6186 | 17.7 | 1 | 12 | 0.96 | 1Score > 41 indicates identity Score > 25 indicates homology |
YADHKLLLSE |
| 1795 |
669.3620 | 1336.7094 | 1336.7139 | -3.34 | 0 | 12 | 0.67 | 1Score > 39 indicates identity Score > 23 indicates homology |
WKPLQPVSQPR + 2 Deamidated (NQ) |
| 803 |
447.7252 | 893.4358 | 893.4528 | -19.0 | 1 | 12 | 0.78 | 1Score > 42 indicates identity Score > 24 indicates homology |
KSMAVTIE + Oxidation (M) |
| 1050 |
496.2849 | 990.5552 | 990.5386 | 16.8 | 1 | 12 | 0.97 | 1Score > 40 indicates identity Score > 25 indicates homology |
ALVTFPSEK |
| 1536 |
609.8104 | 1217.6062 | 1217.5962 | 8.28 | 0 | 12 | 0.93 | 1Score > 42 indicates identity Score > 25 indicates homology |
QGLANLMDDLK + Deamidated (NQ) |
| 376 |
349.7329 | 697.4512 | 697.4374 | 19.8 | 1 | 12 | 0.87 | 1Score > 34 indicates identity Score > 24 indicates homology |
IVPIEK |
| 1269 |
549.8721 | 1097.7296 | 1097.7172 | 11.3 | 1 | 12 | 0.41 | 1Score > 21 indicates identity |
IIVSLIKQGK |
| 4186 |
702.8945 | 2807.5489 | 2807.5605 | -4.14 | 1 | 12 | 0.12 | 1Score > 31 indicates identity Score > 16 indicates homology |
LSNLQAMLPILEAVVQTSKPLVIISE + 2 Deamidated (NQ) |
| 1511 |
604.8115 | 1207.6084 | 1207.5867 | 18.0 | 1 | 12 | 0.36 | 1Score > 41 indicates identity Score > 20 indicates homology |
LTASVESCSVR |
| 1126 |
510.7932 | 1019.5718 | 1019.5539 | 17.6 | 1 | 12 | 0.61 | 1Score > 38 indicates identity Score > 23 indicates homology |
QIELLYIE |
| 3011 |
654.9883 | 1961.9431 | 1961.9807 | -19.2 | 1 | 12 | 0.45 | 1Score > 40 indicates identity Score > 21 indicates homology |
QRASAGQISVQPTFSVQR + 3 Deamidated (NQ) |
| 3913 |
841.1318 | 2520.3736 | 2520.3295 | 17.5 | 1 | 12 | 0.16 | 1Score > 33 indicates identity Score > 17 indicates homology |
ALNPNNQTQAINALIANAKNGLVR + 3 Deamidated (NQ) |
| 789 |
887.4670 | 886.4597 | 886.4760 | -18.4 | 1 | 12 | 0.75 | 1Score > 42 indicates identity Score > 24 indicates homology |
VEVIGGADK |
| 3018 |
657.0110 | 1968.0112 | 1968.0316 | -10.4 | 1 | 12 | 0.11 | 1Score > 39 indicates identity Score > 15 indicates homology |
ILQDIASGSHPFSQVLKE |
| 2060 |
490.9280 | 1469.7622 | 1469.7661 | -2.65 | 0 | 12 | 0.83 | 1Score > 40 indicates identity Score > 24 indicates homology |
TPQTLVGGPVAMQR + Oxidation (M) |
| 2434 |
544.6342 | 1630.8808 | 1630.8964 | -9.57 | 0 | 12 | 0.9 | 1Score > 39 indicates identity Score > 24 indicates homology |
LVLTLGSQMVVLANR + 2 Deamidated (NQ); Oxidation (M) |
| 2597 |
429.4654 | 1713.8325 | 1713.7985 | 19.8 | 0 | 12 | 0.59 | 1Score > 40 indicates identity Score > 22 indicates homology |
VIAYTPVDQYLSNTE + 2 Deamidated (NQ) |
| 2714 |
593.3214 | 1776.9424 | 1776.9509 | -4.80 | 0 | 12 | 0.15 | 1Score > 39 indicates identity Score > 16 indicates homology |
AISLAYATGQSLLGLIGE + Deamidated (NQ) |
| 1799 |
671.3810 | 1340.7474 | 1340.7551 | -5.72 | 0 | 12 | 0.71 | 1Score > 38 indicates identity Score > 23 indicates homology |
LNPSLVISLSQGL + Deamidated (NQ) |
| 1942 |
705.3657 | 1408.7168 | 1408.7238 | -4.96 | 1 | 12 | 0.71 | 1Score > 40 indicates identity Score > 23 indicates homology |
DDVFFIANVKIE |
| 2839 |
928.4576 | 1854.9006 | 1854.8748 | 13.9 | 0 | 12 | 0.82 | 1Score > 40 indicates identity Score > 24 indicates homology |
EPSGGNNWAPLQAGDTLK + Deamidated (NQ) |
| 3420 |
1094.5327 | 2187.0508 | 2187.0378 | 5.95 | 0 | 12 | 0.22 | 1Score > 39 indicates identity Score > 18 indicates homology |
TVFAASQQSAAGAGMLPSHQAR + 2 Deamidated (NQ) |
| 1446 |
589.2975 | 1176.5804 | 1176.6026 | -18.8 | 1 | 12 | 0.91 | 1Score > 42 indicates identity Score > 24 indicates homology |
TNPALYGELAK + Deamidated (NQ) |
| 2101 |
498.9254 | 1493.7544 | 1493.7337 | 13.8 | 1 | 12 | 0.53 | 1Score > 41 indicates identity Score > 22 indicates homology |
STGFIQMFYTKR + Oxidation (M) |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/