MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita5 sp
MS data file : PRT1270_T-BRSC_5_20250714121805.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 23:42:02 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,997

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 221–230 (out of 240)


Page: Previous 1 18 19 20 21 22 23 24 Next 

+221

Accession Score Description
1 ACEA_ECOLI 25 Isocitrate lyase OS=Escherichia coli (strain K12) GN=aceA PE=1 SV=1

+222

Accession Score Description
1 MUTL_ECOBW 24 DNA mismatch repair protein mutL OS=Escherichia coli (strain K12 / BW2952) GN=mutL PE=3 SV=1

+223

Accession Score Description
1 TNP7_ECOLX 24 Transposase for transposon Tn3926 OS=Escherichia coli GN=tnpA PE=3 SV=1

+224

Accession Score Description
1 CTAQ_THEAQ 24 Thermostable carboxypeptidase 1 OS=Thermus aquaticus PE=1 SV=2

+225

Accession Score Description
1 PGK_AERHH 23 Phosphoglycerate kinase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / NCIB 9240) GN=pgk PE=3 SV=1

+226

Accession Score Description
1 PYRF_THERP 23 Orotidine 5'-phosphate decarboxylase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=pyrF PE=3 SV=1

+227

Accession Score Description
1 RL18_GLOVI 23 50S ribosomal protein L18 OS=Gloeobacter violaceus GN=rplR PE=3 SV=1

+228

Accession Score Description
1 UGPI6_ARATH 23 Uncharacterized GPI-anchored protein At1g61900 OS=Arabidopsis thaliana GN=At1g61900 PE=1 SV=1

-229

Accession Score Description
1 TRMN6_BACTN 22 tRNA (adenine-N(6)-)-methyltransferase OS=Bacteroides thetaiotaomicron GN=BT_0838 PE=3 SV=2
Score Mass Matches Sequences emPAI
229.1 TRMN6_BACTN 22 26902 1 (1) 1 (1) 0.09
tRNA (adenine-N(6)-)-methyltransferase OS=Bacteroides thetaiotaomicron GN=BT_0838 PE=3 SV=2

-1 peptide matches (1 non-duplicate, 0 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
4739   747.6006 3732.9666 3732.9985 -8.55 1 22 0.017 +1Score > 32 indicates identity
Score > 17 indicates homology
U K.VGTDGVLLGAWASVQGAHRILDIGTGTGLVALMLAQR.S + Deamidated (NQ); Oxidation (M)

+230

Accession Score Description
1 RS6_AZOVD 22 30S ribosomal protein S6 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rpsF PE=3 SV=1
Page: Previous 1 18 19 20 21 22 23 24 Next 

Not what you expected? Try the select summary.