MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita5 sp
MS data file : PRT1270_T-BRSC_5_20250714121805.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 23:42:02 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,997

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 1–10 (out of 240)


Page: 1 2 3 4 5 6  24 Next 

+1

Accession Score Description
Family member distances as a dendrogram 1 EFTU2_PSEPK 1313 Elongation factor Tu-B OS=Pseudomonas putida (strain KT2440) GN=tufB PE=3 SV=1
3 EFTU_CARRP 105 Elongation factor Tu OS=Carsonella ruddii (strain PV) GN=tuf PE=3 SV=1
2 EFTU1_PSEPK 1215 Elongation factor Tu-A OS=Pseudomonas putida (strain KT2440) GN=tufA PE=3 SV=1

-2

Accession Score Description
Family member distances as a dendrogram 1 ATPB_PSEPG 945 ATP synthase subunit beta OS=Pseudomonas putida (strain GB-1) GN=atpD PE=3 SV=1
2 ATPB_PSEU5 708 ATP synthase subunit beta OS=Pseudomonas stutzeri (strain A1501) GN=atpD PE=3 SV=1
4 ATPB_LEGPA 195 ATP synthase subunit beta OS=Legionella pneumophila (strain Paris) GN=atpD PE=3 SV=1
3 ATPB_PSE14 666 ATP synthase subunit beta OS=Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6) GN=atpD PE=3 SV=1
Cut threshold

Score Mass Matches Sequences emPAI
ATPB_PSEPG 945 49415 39 (27) 17 (13) 1.07
ATP synthase subunit beta OS=Pseudomonas putida (strain GB-1) GN=atpD PE=3 SV=1
2 samesets of ATPB_PSEPG
ATPB_PSEPK 945 49385 39 (27) 17 (13) 1.07
ATP synthase subunit beta OS=Pseudomonas putida (strain KT2440) GN=atpD PE=3 SV=1
ATPB_PSEP1 945 49385 39 (27) 17 (13) 1.07
ATP synthase subunit beta OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=atpD PE=3 SV=1
ATPB_PSEU5 708 49844 29 (21) 11 (10) 0.79
ATP synthase subunit beta OS=Pseudomonas stutzeri (strain A1501) GN=atpD PE=3 SV=1
ATPB_PSE14 666 49548 28 (19) 12 (10) 0.80
ATP synthase subunit beta OS=Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6) GN=atpD PE=3 SV=1
2 samesets of ATPB_PSE14
ATPB_PSESM 666 49518 28 (19) 12 (10) 0.80
ATP synthase subunit beta OS=Pseudomonas syringae pv. tomato GN=atpD PE=3 SV=1
ATPB_PSEU2 666 49518 28 (19) 12 (10) 0.80
ATP synthase subunit beta OS=Pseudomonas syringae pv. syringae (strain B728a) GN=atpD PE=3 SV=1
ATPB_LEGPA 195 50052 16 (10) 8 (5) 0.31
ATP synthase subunit beta OS=Legionella pneumophila (strain Paris) GN=atpD PE=3 SV=1
3 samesets of ATPB_LEGPA
ATPB_LEGPC 195 50052 16 (10) 8 (5) 0.31
ATP synthase subunit beta OS=Legionella pneumophila (strain Corby) GN=atpD PE=3 SV=1
ATPB_LEGPH 195 50052 16 (10) 8 (5) 0.31
ATP synthase subunit beta OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=atpD PE=3 SV=1
ATPB_LEGPL 195 50052 16 (10) 8 (5) 0.31
ATP synthase subunit beta OS=Legionella pneumophila (strain Lens) GN=atpD PE=3 SV=1

-50 peptide matches (32 non-duplicate, 18 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U 1 2 3 4 Peptide
Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U 1 2 3 4 Peptide
D:\Xcalibur\Data\Jennifer\PRT1270 Rita DDA\PRT1270_T-BRSC_5_20250714121805.raw

Score > 31 indicates identity

Score > 20 indicates homology

2.79 0 11 0.41 1 YVSIK  
214   305.1848 608.3550 608.3533 2.79 0 11 0.41 -1Score > 31 indicates identity
Score > 20 indicates homology
X X X K.YVSLK.D
2.79 0 7 1.2 3 YVISK  
2.79 0 7 1.2 3 YVLSK  
2.77 0 7 1.2 3 YVTVK  
2.77 0 7 1.2 3 YVVTK  
2.79 0 3 2.8 7 YSVIK  
2.79 0 3 2.8 7 YSVLK  
2.79 0 2 3.3 9 VYSIK  
2.79 0 2 3.3 9 VYSLK  
580   790.3965 789.3892 789.3868 3.02 0 48 0.018 +1Score > 43 indicates identity U X X X X K.DSNVLDK.V
581   395.7021 789.3896 789.3868 3.56 0 27 1.8 +3Score > 43 indicates identity
Score > 42 indicates homology
U X X X X K.DSNVLDK.V
984   961.5515 960.5442 960.5393 5.14 0 62 0.00026 +1Score > 39 indicates identity U X X X X K.VGLFGGAGVGK.T
985 +2 481.2799 960.5452 960.5393 6.20 0 63 0.00024 +1Score > 39 indicates identity U X X X X K.VGLFGGAGVGK.T
988 +1 481.7765 961.5384 961.5345 4.09 0 35 0.17 +1Score > 39 indicates identity U X X X R.GVQYVLQR.Y
989   962.5462 961.5389 961.5345 4.59 0 46 0.011 +1Score > 39 indicates identity U X X X R.GVQYVLQR.Y
992   482.2687 962.5228 962.5185 4.49 0 11 4.6 +6Score > 41 indicates identity
Score > 30 indicates homology
U X X X R.GVQYVLQR.Y + Deamidated (NQ)
1278   553.7932 1105.5718 1105.5624 8.58 1 20 0.71 +1Score > 42 indicates identity
Score > 31 indicates homology
U X X X X K.TVNMMELIR.N
1308   561.3213 1120.6280 1120.6128 13.6 0 36 0.086 +1Score > 38 indicates identity U X K.DTIAGFSGILK.G
1337   567.3211 1132.6276 1132.6162 10.1 1 45 0.0036 +1Score > 39 indicates identity
Score > 34 indicates homology
U X X X X R.VALTGLTMAEK.F
1505 +1 602.8391 1203.6636 1203.6499 11.4 0 20 0.4 +1Score > 39 indicates identity
Score > 29 indicates homology
U X R.DVVPSVYNALK.V
1644   421.8969 1262.6689 1262.6653 2.85 1 42 0.0064 +1Score > 41 indicates identity
Score > 32 indicates homology
U X R.TIAMGTTDGLKR.G
2025   484.2714 1449.7924 1449.7827 6.65 1 63 1.1e-005 +1Score > 38 indicates identity
Score > 26 indicates homology
U X X X R.YTLAGTEVSALLGR.M
2027 +1 725.9100 1449.8054 1449.7827 15.7 1 78 8.8e-008 +1Score > 37 indicates identity
Score > 20 indicates homology
U X X X R.YTLAGTEVSALLGR.M
2342   533.3038 1596.8896 1596.8723 10.8 0 16 0.46 +1Score > 37 indicates identity
Score > 25 indicates homology
U X R.GLDVVDTGAAISVPVGK.A
2343 +2 799.4521 1596.8896 1596.8723 10.9 0 93 1.6e-007 +1Score > 37 indicates identity U X R.GLDVVDTGAAISVPVGK.A
2459   822.9131 1643.8116 1643.8090 1.64 0 89 8.6e-008 +1Score > 41 indicates identity
Score > 31 indicates homology
U X X X K.VALVYGQMNEPPGNR.L
2506 +1 834.9991 1667.9836 1667.9610 13.6 1 102 4.1e-009 +1Score > 30 indicates identity U X X X R.IVQIIGAVIDVEFPR.D
2507 +1 557.0026 1667.9860 1667.9610 14.9 1 60 6e-005 +1Score > 30 indicates identity U X X X R.IVQIIGAVIDVEFPR.D
2590   571.3325 1710.9757 1710.9556 11.7 1 33 0.044 +1Score > 34 indicates identity
Score > 32 indicates homology
U X K.YVSLKDTIAGFSGILK.G
2836   928.4530 1854.8914 1854.8860 2.92 1 55 0.002 +1Score > 40 indicates identity U X R.QLDPNVIGQEHYDTAR.G
2836   928.4530 1854.8914 1854.9112 -10.6 1 43 0.027 +2Score > 40 indicates identity U X R.QLDPLVIGQEHYDTAR.G + Deamidated (NQ)
2836   928.4530 1854.8914 1854.9112 -10.6 1 32 0.32 +3Score > 40 indicates identity U X R.QLDPLIVGQEHYDTAR.R + Deamidated (NQ)
2837 +1 619.3057 1854.8953 1854.8860 4.98 1 25 0.85 +1Score > 40 indicates identity
Score > 37 indicates homology
U X R.QLDPNVIGQEHYDTAR.G
2837 +1 619.3057 1854.8953 1854.9112 -8.58 1 23 1.4 +2Score > 40 indicates identity
Score > 37 indicates homology
U X R.QLDPLVIGQEHYDTAR.G + Deamidated (NQ)
2837 +1 619.3057 1854.8953 1854.9112 -8.58 1 14 11 +3Score > 40 indicates identity
Score > 37 indicates homology
U X R.QLDPLIVGQEHYDTAR.R + Deamidated (NQ)
3005 +2 979.5222 1957.0298 1956.9986 16.0 1 83 1.7e-006 +1Score > 38 indicates identity U X X X R.FLSQPFFVAEVFTGSPGK.Y
3059 +2 995.5225 1989.0304 1989.0055 12.6 0 97 1.2e-008 +1Score > 39 indicates identity
Score > 30 indicates homology
U X X X R.DIASLGIYPAVDPLDSTSR.Q
3822 +2 813.0837 2436.2293 2436.1921 15.3 1 80 1.1e-007 +1Score > 38 indicates identity
Score > 23 indicates homology
U X R.GIHQPAPSFADQAGGNDLLETGIK.V + Deamidated (NQ)
4768   961.9998 3843.9701 3843.9055 16.8 1 42 0.0074 +1Score > 33 indicates identity U X K.EGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSR.D + Deamidated (NQ)
4768   961.9998 3843.9701 3843.9055 16.8 0 39 0.014 +2Score > 33 indicates identity U X K.NGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSR.D + 2 Deamidated (NQ)

+42 subsets and intersections (598 subset proteins in total)


+3

Accession Score Description
Family member distances as a dendrogram 1 CH60_PSEPK 849 60 kDa chaperonin OS=Pseudomonas putida (strain KT2440) GN=groL PE=3 SV=1
2 CH602_SORC5 95 60 kDa chaperonin 2 OS=Sorangium cellulosum (strain So ce56) GN=groL2 PE=3 SV=1

+4

Accession Score Description
Family member distances as a dendrogram 1 ATPA_PSEPK 777 ATP synthase subunit alpha OS=Pseudomonas putida (strain KT2440) GN=atpA PE=3 SV=1
2 ATPA_RICAH 168 ATP synthase subunit alpha OS=Rickettsia akari (strain Hartford) GN=atpA PE=3 SV=1
3 ATPA_VEREI 155 ATP synthase subunit alpha OS=Verminephrobacter eiseniae (strain EF01-2) GN=atpA PE=3 SV=1

+5

Accession Score Description
1 ARCA_PSEPK 648 Arginine deiminase OS=Pseudomonas putida (strain KT2440) GN=arcA PE=3 SV=1

+6

Accession Score Description
1 RL1_PSEE4 454 50S ribosomal protein L1 OS=Pseudomonas entomophila (strain L48) GN=rplA PE=3 SV=1

+7

Accession Score Description
1 ADHP_ECOLI 447 Alcohol dehydrogenase, propanol-preferring OS=Escherichia coli (strain K12) GN=adhP PE=1 SV=1

+8

Accession Score Description
1 OTCC_PSEPK 407 Ornithine carbamoyltransferase, catabolic OS=Pseudomonas putida (strain KT2440) GN=arcB PE=3 SV=3

+9

Accession Score Description
Family member distances as a dendrogram 1 RPOB_PSEPG 398 DNA-directed RNA polymerase subunit beta OS=Pseudomonas putida (strain GB-1) GN=rpoB PE=3 SV=1
6 RPOB_CHRSD 115 DNA-directed RNA polymerase subunit beta OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rpoB PE=3 SV=1
3 RPOB_SACD2 141 DNA-directed RNA polymerase subunit beta OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rpoB PE=3 SV=1
5 FTSZ_PSEPK 123 Cell division protein ftsZ OS=Pseudomonas putida (strain KT2440) GN=ftsZ PE=3 SV=3
2 RPOC_PSEE4 267 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas entomophila (strain L48) GN=rpoC PE=3 SV=1
7 RPOC_COXBN 77 DNA-directed RNA polymerase subunit beta' OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rpoC PE=3 SV=1
4 RPOC_SYNAS 131 DNA-directed RNA polymerase subunit beta' OS=Syntrophus aciditrophicus (strain SB) GN=rpoC PE=3 SV=1

+10

Accession Score Description
1 SAHH_PSEP1 340 Adenosylhomocysteinase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ahcY PE=3 SV=1
Page: 1 2 3 4 5 6  24 Next 

Not what you expected? Try the select summary.