MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita4 sp
MS data file : PRT1270_T-BRSC_4_20250714120925.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 23:41:34 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,786

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 2901–3000 (out of 3754)

Page: Previous 1 …25 26 27 28 29 30 31 32 33 34 35 … 38 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
4667 1011.7524 4042.9805 4042.9249 13.7 1 0 0.94 +1Score > 34 indicates identity
Score > 13 indicates homology		 RFSSLHAVLYFSPDFMSLGFMVWASGSMVFFLYR + 3 Oxidation (M)
1310 533.2810 1064.5474 1064.5661 -17.6 1 0 0.94 +1Score > 40 indicates identity
Score > 13 indicates homology		 HRPPRGMSK
4399 792.4250 3165.6709 3165.7123 -13.1 0 0 1 +1Score > 33 indicates identity
Score > 13 indicates homology		 TMTFRPLSQLMFWILVANLLILTWVGS + Oxidation (M)
4074 904.4688 2710.3846 2710.4112 -9.82 1 0 0.93 +1Score > 37 indicates identity
Score > 13 indicates homology		 SLLNQMNPDHYNGASLIGLRGIVVK + 2 Deamidated (NQ)
3828 813.1085 2436.3037 2436.2901 5.59 0 0 1 +1Score > 36 indicates identity
Score > 13 indicates homology		 STHPPLVLFGSLPSNVTSQLTLE
4248 729.8391 2915.3273 2915.3762 -16.8 1 0 0.96 +1Score > 36 indicates identity
Score > 13 indicates homology		 DVPIVRAMPNTAIQHCQSMTCLAIR + 2 Deamidated (NQ); 2 Oxidation (M)
4338 764.9196 3055.6493 3055.6164 10.8 0 0 0.95 +1Score > 32 indicates identity
Score > 13 indicates homology		 MINLAQIAGNAPLYIVHLSNGLGLDYLR + Deamidated (NQ); Oxidation (M)
4668 1013.0370 4048.1189 4048.1835 -15.9 1 0 1 +1Score > 31 indicates identity
Score > 13 indicates homology		 LYGRRPLNIFGYTLFALMQIPTALSVNLAMFVVFR + Deamidated (NQ); Oxidation (M)
4703 1053.5298 4210.0901 4210.0589 7.42 1 0 1 +1Score > 32 indicates identity
Score > 13 indicates homology		 VVSVPNINMLLSQPQSYLQQLFDPNSVLLTLEASASME + 3 Deamidated (NQ); 2 Oxidation (M)
3416 718.4158 2152.2256 2152.2402 -6.78 1 0 1 +1Score > 31 indicates identity
Score > 13 indicates homology		 LSTTRMTLNKPIAVVLNPGK
3836 611.2970 2441.1589 2441.1135 18.6 1 0 1 +1Score > 38 indicates identity
Score > 13 indicates homology		 VNPNQQLPQSNRIYDFSQYE + 2 Deamidated (NQ)
4143 931.5192 2791.5358 2791.5769 -14.7 0 0 1 +1Score > 32 indicates identity
Score > 13 indicates homology		 LAVSGTVNDLAVMGAKPLALSLSLIIPE
3635 763.7552 2288.2438 2288.2066 16.3 1 0 1 +1Score > 35 indicates identity
Score > 13 indicates homology		 WIIDGYTHSSRLPYSKPLR
4727 1175.0957 4696.3537 4696.2640 19.1 1 0 1 +1Score > 30 indicates identity
Score > 13 indicates homology		 NTIAVPTGGWAVIRFVADNPGMWYMHCHFDAHISLGLAMVLE
3587 750.4453 2248.3141 2248.2839 13.4 1 0 1 +1Score > 27 indicates identity
Score > 13 indicates homology		 MIPALFLAAALGGMLRFLLSK + Oxidation (M)
2937 615.3407 1843.0003 1843.0066 -3.44 1 0 0.96 +1Score > 37 indicates identity
Score > 13 indicates homology		 VIYMGTFAKTLFPSLR
3305 699.3755 2095.1047 2095.0850 9.38 1 0 1 +1Score > 37 indicates identity
Score > 13 indicates homology		 RLNHLNLNHLYAFVAVAE + 2 Deamidated (NQ)
4038 895.4531 2683.3375 2683.3533 -5.92 1 0 1 +1Score > 38 indicates identity
Score > 13 indicates homology		 NGLHLDAFFKYLFAVTNSPLSSLE + Deamidated (NQ)
4174 940.8478 2819.5216 2819.4845 13.2 1 0 1 +1Score > 33 indicates identity
Score > 13 indicates homology		 GVQPLLDAVVDYLPSPVDVPAIKGIDE + Deamidated (NQ)
4704 1064.0175 4252.0409 4252.0601 -4.51 1 0 1 +1Score > 32 indicates identity
Score > 13 indicates homology		 LVHFGVGDVSANDVNLAETFDGVIYGFNVNAGNVIQQSAAK + 3 Deamidated (NQ)
563 722.4113 721.4040 721.4010 4.17 1 0 1 +1Score > 40 indicates identity
Score > 13 indicates homology		 LAKYVE
3584 1124.6353 2247.2560 2247.2263 13.2 1 0 1 +1Score > 32 indicates identity
Score > 13 indicates homology		 APFIQITGLGGSALVGRDLSFK + Deamidated (NQ)
4100 917.1354 2748.3844 2748.3608 8.58 1 0 1 +1Score > 37 indicates identity
Score > 13 indicates homology		 EVSAQYGNDIIFLFLGGFILAIAME + 2 Deamidated (NQ); Oxidation (M)
3365 1067.5763 2133.1380 2133.1542 -7.57 1 0 1 +1Score > 37 indicates identity
Score > 13 indicates homology		 EVISALNARPGHQTVIITGR + 2 Deamidated (NQ)
3862 825.0994 2472.2764 2472.3021 -10.4 1 0 1 +1Score > 37 indicates identity
Score > 13 indicates homology		 WAINNVSLALPPTPYLAAMKMR + Oxidation (M)
4188 948.5597 2842.6573 2842.6363 7.39 1 0 1 +1Score > 24 indicates identity
Score > 13 indicates homology		 VIAQLTMIAMIGIAGPMIIFLLAVRR + 2 Oxidation (M)
3898 837.4000 2509.1782 2509.1835 -2.11 1 0 1 +1Score > 38 indicates identity
Score > 13 indicates homology		 NSTYKNPYTKPYVIYMSPQGR + 3 Deamidated (NQ)
4298 998.8333 2993.4781 2993.4508 9.11 1 0 1 +1Score > 37 indicates identity
Score > 13 indicates homology		 LGLGSMGVGVGGNLSMMGGLDNKTNQDILK + 2 Deamidated (NQ); Oxidation (M)
3117 658.0421 1971.1045 1971.1193 -7.53 0 0 1 +1Score > 34 indicates identity
Score > 13 indicates homology		 LHLYVISTTSSIFLHLK
3508 735.3604 2203.0594 2203.0694 -4.53 1 0 1 +1Score > 39 indicates identity
Score > 13 indicates homology		 MKTYDTYVGIGWLIPGMDK + Oxidation (M)
4240 970.4845 2908.4317 2908.3951 12.6 0 0 1 +1Score > 37 indicates identity
Score > 13 indicates homology		 QPTYPALVLPNTGAGGAAATAAPDGGGGGGGGAR + 2 Deamidated (NQ)
4778 916.3393 6407.3242 6407.3142 1.56 1 0 1 +1Score > 26 indicates identity
Score > 13 indicates homology		 VTQGVTLMSGMILLTWQKIAPMSILYQISPSINTNLLMLMALTSVLVGGWGGLNQTQLR + 7 Deamidated (NQ)
3739 590.3235 2357.2649 2357.2511 5.83 1 0 1 +1Score > 36 indicates identity
Score > 13 indicates homology		 IANTLNNLQGQMAVITKILNGK + 4 Deamidated (NQ)
4238 969.4883 2905.4431 2905.4533 -3.52 1 0 0.99 +1Score > 37 indicates identity
Score > 13 indicates homology		 CNLYLLPTGEIVYFMAAVVILYNVE + 2 Deamidated (NQ)
4648 991.5511 3962.1753 3962.1298 11.5 1 0 0.99 +1Score > 28 indicates identity
Score > 13 indicates homology		 LAKQLHQQQHQLQLQLQQIKPKPISSMISQPVNK + 5 Deamidated (NQ)
4383 785.3949 3137.5505 3137.5445 1.92 1 0 1 +1Score > 36 indicates identity
Score > 13 indicates homology		 VGDKPSAGLFIFSQQDNEPVALVTKFAGAE + 3 Deamidated (NQ)
3897 837.1102 2508.3088 2508.3258 -6.77 1 0 1 +1Score > 37 indicates identity
Score > 13 indicates homology		 DIALAQGAVLVKSCQVPDGSIPIR + 2 Deamidated (NQ)
4099 916.5325 2746.5757 2746.5229 19.2 1 0 0.96 +1Score > 27 indicates identity
Score > 13 indicates homology		 QTDVDVVIVGAGPAGLTLANILGLEGVR
4763 1156.6217 5778.0721 5777.9984 12.8 0 0 1 +1Score > 26 indicates identity
Score > 13 indicates homology		 WAAMLMTLMIYLLSMNLLGLLPYTFTPTTQLSMNMALAIPLWLATVLTGLR + 2 Deamidated (NQ); 4 Oxidation (M)
3987 653.3379 2609.3225 2609.2795 16.5 1 0 1 +1Score > 37 indicates identity
Score > 13 indicates homology		 LPTSFQKGCVNSTANYQLLEPNK + Deamidated (NQ)
4407 636.7309 3178.6181 3178.5645 16.9 1 0 1 +1Score > 35 indicates identity
Score > 13 indicates homology		 YSGAMVSDIHRILVQGGVFLYPGTIQNPE + 2 Deamidated (NQ); Oxidation (M)
4498 1111.5913 3331.7521 3331.8014 -14.8 0 0 1 +1Score > 33 indicates identity
Score > 13 indicates homology		 NSVVALIPAIILSDGVVTLDGVPAISDVDNLIE + Deamidated (NQ)
935 907.4623 906.4550 906.4554 -0.46 0 0 1 +1Score > 42 indicates identity
Score > 13 indicates homology		 LLLLMCE + Oxidation (M)
4203 717.9121 2867.6193 2867.5756 15.2 1 0 1 +1Score > 28 indicates identity
Score > 13 indicates homology		 NALQGLLNPITQAIYPRISSTLVLNR + 3 Deamidated (NQ)
4130 927.4840 2779.4302 2779.4352 -1.81 1 0 1 +1Score > 36 indicates identity
Score > 13 indicates homology		 TPSTVALRTSTSAQAPVVQPVPASQQR + 3 Deamidated (NQ)
4425 800.7020 3198.7789 3198.7573 6.74 1 0 1 +1Score > 29 indicates identity
Score > 13 indicates homology		 ITKQNITITINNSVILTIIQYGHIDMLK + 2 Deamidated (NQ)
3720 781.4149 2341.2229 2341.2212 0.71 1 0 1 +1Score > 37 indicates identity
Score > 13 indicates homology		 THHNVGGLPANMNLKLIEPLR + 2 Deamidated (NQ); Oxidation (M)
4266 982.1442 2943.4108 2943.4184 -2.61 1 0 1 +1Score > 37 indicates identity
Score > 13 indicates homology		 NIVALNAGAALYACGNASHIAEGVHYASK + 2 Deamidated (NQ)
4775 870.7338 6088.0857 6088.1558 -11.5 1 0 1 +1Score > 27 indicates identity
Score > 13 indicates homology		 TAVVNLTQLILGFATMVLAMSLALGFGNSFFVKTAHVVFGAMVAFAIVACVYFSIIE + 3 Deamidated (NQ); Oxidation (M)
4328 1013.5225 3037.5457 3037.5859 -13.2 1 0 1 +1Score > 36 indicates identity
Score > 13 indicates homology		 ATITLSDNGSANILLDKIGGLTAFNQFLK + 3 Deamidated (NQ)
3923 844.4357 2530.2853 2530.2872 -0.74 1 0 1 +1Score > 38 indicates identity
Score > 13 indicates homology		 WLVWIMASIGTIYVFFFHER + Oxidation (M)
4270 738.4025 2949.5809 2949.6063 -8.61 1 0 1 +1Score > 33 indicates identity
Score > 13 indicates homology		 SSGGLLLLLGPLTLWEVLTPVSSTDRPE
4283 990.5213 2968.5421 2968.5461 -1.35 1 0 1 +1Score > 35 indicates identity
Score > 13 indicates homology		 LGPIALSHQFATGFHPGFAFTVVRQDR
1 301.1879 300.1806
2 301.6677 300.6604
3 301.9114 300.9041
4 303.0620 302.0547
5 303.1786 302.1713
6 303.1789 302.1716
7 303.1793 302.1720
8 304.1626 303.1553
9 304.1627 303.1554
10 304.1628 303.1555
11 305.0110 304.0037
12 305.0126 304.0053
13 309.0326 308.0253
14 309.0329 308.0256
15 314.6934 313.6861
16 315.2032 314.1959
17 317.1941 316.1868
18 317.2188 316.2115
19 317.2192 316.2119
20 317.2194 316.2121
21 317.2195 316.2122
22 317.2195 316.2122
23 321.1853 320.1780
24 321.6835 320.6762
25 321.6839 320.6766
26 322.1886 321.1813
27 322.1887 321.1814
28 331.2349 330.2276
29 331.2351 330.2278
30 331.2354 330.2281
31 333.1894 332.1821
32 333.1906 332.1833
33 333.2076 332.2003
34 333.2145 332.2072
35 336.1898 335.1825
36 337.2171 336.2098
37 337.2598 336.2525
38 337.8465 336.8392
39 338.1837 337.1764
40 343.2099 342.2026
41 344.1944 343.1871
42 344.6855 343.6782
43 344.7161 343.7088
44 345.2255 344.2182
45 345.2255 344.2182
46 345.2256 344.2183
47 345.2257 344.2184
Page: Previous 1 …25 26 27 28 29 30 31 32 33 34 35 … 38 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/