MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita4 sp
MS data file : PRT1270_T-BRSC_4_20250714120925.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 23:41:34 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,786

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 2601–2700 (out of 3754)

Page: Previous 1 …22 23 24 25 26 27 28 29 30 31 32 … 38 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2276 755.4116 1508.8086 1508.7946 9.28 0 2 0.92 +1Score > 38 indicates identity
Score > 14 indicates homology		 ADAAAAGAAALAPQALR + Deamidated (NQ)
3461 728.3807 2182.1203 2182.1052 6.89 0 2 0.98 +1Score > 38 indicates identity
Score > 14 indicates homology		 TLGTKPDVVLSDMAAPTTGHR + Oxidation (M)
2336 769.4326 1536.8506 1536.8399 6.99 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 QFSKVLSTLTAVNK + 2 Deamidated (NQ)
3946 852.1151 2553.3235 2553.3373 -5.42 0 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 NVLAIAAGIAAGMDFGVNAHAALITR + Deamidated (NQ); Oxidation (M)
3490 549.2781 2193.0833 2193.0789 2.00 1 2 0.96 +1Score > 39 indicates identity
Score > 14 indicates homology		 LHSNSLQHVPPTWFKNMR + 2 Deamidated (NQ)
220 474.2923 473.2850 473.2850 0.14 0 2 0.66 +1Score > 43 indicates identity
Score > 13 indicates homology		 IVGSV
2959 929.0021 1855.9896 1855.9978 -4.41 1 2 0.65 +1Score > 38 indicates identity
Score > 13 indicates homology		 KHDGQFTVIQLLGMLR + Deamidated (NQ)
4272 985.5253 2953.5541 2953.5032 17.2 1 2 1 +1Score > 35 indicates identity
Score > 15 indicates homology		 LSSAQQTDINLPYITADQSGPKHLNIK + 2 Deamidated (NQ)
3515 736.3655 2206.0747 2206.0504 11.0 1 2 0.97 +1Score > 39 indicates identity
Score > 14 indicates homology		 VYEDLVNYTVMYNVIPTR + 2 Deamidated (NQ); Oxidation (M)
4319 757.6508 3026.5741 3026.5383 11.8 1 2 1 +1Score > 35 indicates identity
Score > 15 indicates homology		 MATSSTLPAVVPALGGDQSLNHYLADIRK + 2 Deamidated (NQ)
4609 747.3981 3731.9541 3732.0145 -16.2 1 2 1 +1Score > 32 indicates identity
Score > 15 indicates homology		 VGTDGVLLGAWASVQGAHRILDIGTGTGLVALMLAQR + Oxidation (M)
328 602.3915 601.3842 601.3911 -11.5 1 2 1 +1Score > 41 indicates identity
Score > 15 indicates homology		 VVKTR
4382 785.1478 3136.5621 3136.5461 5.12 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 AMGSLPELLMAGVDTTSNTLTWALYHLSK + Deamidated (NQ); Oxidation (M)
1001 932.4813 931.4740 931.4611 13.9 0 2 0.72 +1Score > 43 indicates identity
Score > 13 indicates homology		 QGSSVGAVVE
3873 827.4299 2479.2679 2479.2357 13.0 1 2 0.77 +1Score > 37 indicates identity
Score > 13 indicates homology		 KDVPGFLQQSQSSGPGQAAVWHR
4414 1061.5272 3181.5598 3181.5140 14.4 1 2 0.98 +1Score > 36 indicates identity
Score > 14 indicates homology		 ECYIYGTVDFIFGNAAVVFQNCIILPR + 3 Deamidated (NQ)
2831 593.6564 1777.9474 1777.9363 6.25 1 2 1 +1Score > 38 indicates identity
Score > 14 indicates homology		 VSNLNYTVKSLQHFK + Deamidated (NQ)
3462 728.3833 2182.1281 2182.0919 16.6 1 2 1 +1Score > 38 indicates identity
Score > 14 indicates homology		 LRDIFHNFDSHAVDLIDR
3831 813.4366 2437.2880 2437.2673 8.49 0 2 0.7 +1Score > 36 indicates identity
Score > 13 indicates homology		 LNQAIQQQLQQANNSLALQASR + Deamidated (NQ)
3953 855.1313 2562.3721 2562.3661 2.31 0 2 0.81 +1Score > 35 indicates identity
Score > 14 indicates homology		 TNKPSKPLNPMINAGALAVTHMIK + Deamidated (NQ); Oxidation (M)
4259 977.8679 2930.5819 2930.5696 4.18 0 2 0.79 +1Score > 33 indicates identity
Score > 13 indicates homology		 YFINLLLFNFFAGLISFLVIMYQK + Deamidated (NQ); Oxidation (M)
3904 837.4751 2509.4035 2509.4011 0.94 1 2 1 +1Score > 31 indicates identity
Score > 14 indicates homology		 LAQLILSMPNLNLRGIMAVPSIK + 2 Deamidated (NQ); Oxidation (M)
4468 817.4157 3265.6337 3265.6443 -3.25 1 2 1 +1Score > 36 indicates identity
Score > 14 indicates homology		 LQLKKPYLCIMFAFLTSEPGAYDGVLYE
3185 672.0016 2012.9830 2013.0088 -12.9 1 2 1 +1Score > 40 indicates identity
Score > 14 indicates homology		 VKLSSDTCYSTTQKPIGK + Deamidated (NQ)
3718 779.7534 2336.2384 2336.2634 -10.7 1 2 1 +1Score > 36 indicates identity
Score > 14 indicates homology		 RHLQDQTVLILGLGASGLAMAR + Deamidated (NQ); Oxidation (M)
4344 1023.4730 3067.3972 3067.4458 -15.9 0 2 1 +1Score > 35 indicates identity
Score > 14 indicates homology		 SSVFSRPSTGGAMGHQSFFTQVPSAAGVPR + 2 Deamidated (NQ); Oxidation (M)
4494 1107.5743 3319.7011 3319.6547 14.0 0 2 1 +1Score > 35 indicates identity
Score > 14 indicates homology		 TIMGLPSTINSISTNLFNNQVWPNLPSFGR + 2 Deamidated (NQ)
3600 754.3955 2260.1647 2260.1223 18.8 1 2 0.96 +1Score > 38 indicates identity
Score > 14 indicates homology		 LSKPSQVSSGQKLGPQNFIDE + 2 Deamidated (NQ)
3625 760.3996 2278.1770 2278.1416 15.5 1 2 0.74 +1Score > 38 indicates identity
Score > 13 indicates homology		 WGYGATGVVSVASNLVPGLMRE + Oxidation (M)
4341 1021.5327 3061.5763 3061.6012 -8.14 1 2 1 +1Score > 36 indicates identity
Score > 14 indicates homology		 SRSGLGLGIGISFFATLVSQLLVYNGVYE + 2 Deamidated (NQ)
4650 1002.0377 4004.1217 4004.1824 -15.2 1 2 1 +1Score > 30 indicates identity
Score > 14 indicates homology		 GHWPYGLFLCKLIPSVIILNMFASVFLLTAISLDR
1049 475.2570 948.4994 948.4950 4.69 1 2 0.79 +1Score > 41 indicates identity
Score > 13 indicates homology		 DLMADIKK + Oxidation (M)
3509 551.7760 2203.0749 2203.0732 0.79 1 2 0.93 +1Score > 39 indicates identity
Score > 14 indicates homology		 IANNGNMNLIFHFLRSPVE + 2 Deamidated (NQ); Oxidation (M)
3824 609.2962 2433.1557 2433.1084 19.4 1 2 0.96 +1Score > 38 indicates identity
Score > 14 indicates homology		 DLAQGLNPNVPQNYYRNDDPK + 3 Deamidated (NQ)
4504 1114.6073 3340.8001 3340.7554 13.4 1 2 0.86 +1Score > 32 indicates identity
Score > 14 indicates homology		 ILSAIDYLHSLEPPIIHGNINAKNILLDNE + 2 Deamidated (NQ)
2869 601.3501 1801.0285 1801.0322 -2.08 1 2 0.86 +1Score > 33 indicates identity
Score > 14 indicates homology		 RAAVAVTAAPGPKPAAPTR
4149 934.8448 2801.5126 2801.5401 -9.83 0 2 0.71 +1Score > 33 indicates identity
Score > 13 indicates homology		 SLMIFFHIVLLAVSLSNNIILTSGAE
3300 1047.5386 2093.0626 2093.0317 14.8 1 2 0.87 +1Score > 39 indicates identity
Score > 14 indicates homology		 APQIIASELVGQINNSYFE + Deamidated (NQ)
3353 532.5060 2125.9949 2126.0327 -17.8 1 2 1 +1Score > 39 indicates identity
Score > 14 indicates homology		 QGIPTACAAFAQQPAGEPRR + Deamidated (NQ)
2417 315.7943 1573.9351 1573.9191 10.2 1 2 0.97 +1Score > 30 indicates identity
Score > 14 indicates homology		 ALEPHVQVLAKQIK + Deamidated (NQ)
2738 575.0254 1722.0544 1722.0515 1.64 1 2 1 +1Score > 24 indicates identity
Score > 14 indicates homology		 DGLLLARPLLSLSKAR
4120 924.5320 2770.5742 2770.5309 15.6 1 2 1 +1Score > 29 indicates identity
Score > 14 indicates homology		 VTIINAFFAAALLVSNTFFNKNIIK + 2 Deamidated (NQ)
4359 1031.5315 3091.5727 3091.6052 -10.5 1 2 0.93 +1Score > 36 indicates identity
Score > 14 indicates homology		 YAQVKPDGTYVKPLSNKLTYGTMVFVR + Deamidated (NQ); Oxidation (M)
3797 805.0871 2412.2395 2412.1916 19.8 0 2 0.93 +1Score > 38 indicates identity
Score > 14 indicates homology		 LTLAGAAMAAMFSSLTQGLLSVNE + Deamidated (NQ); Oxidation (M)
3864 825.4141 2473.2205 2473.2383 -7.23 1 2 0.81 +1Score > 38 indicates identity
Score > 13 indicates homology		 HRAIAGLSMGGGQSFNIGLTNLDK + Deamidated (NQ); Oxidation (M)
4617 538.0039 3758.9764 3758.9593 4.53 1 2 1 +1Score > 32 indicates identity
Score > 14 indicates homology		 MGVYHISGVGFRPGAVTVPLTAVYTLQIAQALGIEE + 2 Deamidated (NQ)
615 752.4005 751.3932 751.3977 -5.92 1 2 0.69 +1Score > 38 indicates identity
Score > 13 indicates homology		 TLPRHE
4260 977.8702 2930.5888 2930.5886 0.067 1 2 1 +1Score > 32 indicates identity
Score > 14 indicates homology		 TIQVSLIVMAISTLQSVLGADLKSSDLE
4639 782.2282 3906.1046 3906.0670 9.62 0 2 1 +1Score > 30 indicates identity
Score > 14 indicates homology		 MITTAVLLLLVTTMVPYQFAYLVACLVQLMTTVR + 2 Deamidated (NQ); 2 Oxidation (M)
3536 741.6851 2222.0335 2222.0195 6.30 1 2 0.73 +1Score > 39 indicates identity
Score > 13 indicates homology		 TISVSDLPNNCLNASSLKCE + Deamidated (NQ)
4470 819.6593 3274.6081 3274.6187 -3.22 1 2 0.77 +1Score > 36 indicates identity
Score > 13 indicates homology		 FGGVYPAATSFPQVITTVASFNASLWESIGR + 2 Deamidated (NQ)
4585 726.5669 3627.7981 3627.8164 -5.04 1 2 0.73 +1Score > 35 indicates identity
Score > 13 indicates homology		 KTINTVVAAMALSTLSFGVFAAEPVTASQAQNMNK + 2 Deamidated (NQ); Oxidation (M)
3909 840.4378 2518.2916 2518.2904 0.48 1 2 0.92 +1Score > 37 indicates identity
Score > 14 indicates homology		 SGIPVMGHIGLTPQFVNRFGGYR + Oxidation (M)
4364 1033.5594 3097.6564 3097.6335 7.38 1 2 0.81 +1Score > 32 indicates identity
Score > 13 indicates homology		 VVSVGGYSAAPASLAALSLGIPLYIHEQNAK + 2 Deamidated (NQ)
4206 718.3818 2869.4981 2869.4830 5.27 0 2 1 +1Score > 35 indicates identity
Score > 14 indicates homology		 SIALCNGISQWVQLMVLSRPTPQLR + 3 Deamidated (NQ)
3646 765.4299 2293.2679 2293.2655 1.04 1 2 1 +1Score > 33 indicates identity
Score > 14 indicates homology		 NIRLANASGPGNLVVLFGAPTGR
3648 1149.1479 2296.2812 2296.2613 8.69 1 2 0.84 +1Score > 33 indicates identity
Score > 14 indicates homology		 VQLEIYSLVQNVAAVMIHLR + Deamidated (NQ)
3652 767.0738 2298.1996 2298.1712 12.4 1 2 0.71 +1Score > 37 indicates identity
Score > 13 indicates homology		 GPNCGLVKNLALMSQITTGVPE
3958 856.4766 2566.4080 2566.3837 9.45 1 2 1 +1Score > 33 indicates identity
Score > 14 indicates homology		 MNKPFLILLIALIAFSGCNMRK + Deamidated (NQ); Oxidation (M)
2915 913.4398 1824.8650 1824.8815 -9.02 1 2 0.97 +1Score > 40 indicates identity
Score > 14 indicates homology		 EQTQDQFQMIVISLK + 2 Deamidated (NQ); Oxidation (M)
3295 697.7393 2090.1961 2090.1623 16.1 1 2 1 +1Score > 30 indicates identity
Score > 14 indicates homology		 YIVNTVLDLGGQTTKILDK
4246 971.4401 2911.2985 2911.3393 -14.0 1 2 0.95 +1Score > 35 indicates identity
Score > 14 indicates homology		 TLQSGVNMFDIDVLNGLIQESGNTSNQ + 2 Deamidated (NQ); Oxidation (M)
3866 826.1042 2475.2908 2475.2423 19.6 1 2 0.81 +1Score > 37 indicates identity
Score > 13 indicates homology		 DIVNMGMAKMVDAPVVLVADIDK + 2 Oxidation (M)
4431 1069.1973 3204.5701 3204.6020 -9.95 1 2 1 +1Score > 36 indicates identity
Score > 14 indicates homology		 MVGSNVAGASLGAALDGMLTTAGIAGRWVQAAR + Deamidated (NQ); 2 Oxidation (M)
2699 569.3155 1704.9247 1704.9046 11.8 1 2 1 +1Score > 38 indicates identity
Score > 14 indicates homology		 LTSLINNAFLVSEQR + Deamidated (NQ)
3900 837.4597 2509.3573 2509.3363 8.36 1 2 1 +1Score > 34 indicates identity
Score > 14 indicates homology		 YRVVVAGPTTVTALLNSLQMGFR + Deamidated (NQ); Oxidation (M)
4073 903.8216 2708.4430 2708.4306 4.58 1 2 0.91 +1Score > 35 indicates identity
Score > 14 indicates homology		 QMGAIITNSLSLKTNYLIVGINAGSK + 3 Deamidated (NQ)
4460 813.4604 3249.8125 3249.7570 17.1 1 2 1 +1Score > 28 indicates identity
Score > 14 indicates homology		 EGFAGLDLSSSAAQSVILMLLVIGLTVIQFR + 2 Deamidated (NQ)
4699 1049.7671 4195.0393 4195.0024 8.79 1 2 0.9 +1Score > 32 indicates identity
Score > 14 indicates homology		 NQPMMVGNWAQSILHGGVIASALDVAAGLVCVGSTLTRHE + 4 Deamidated (NQ); 2 Oxidation (M)
3922 844.4269 2530.2589 2530.2115 18.7 1 2 1 +1Score > 38 indicates identity
Score > 14 indicates homology		 NAYSLFLNSPEASSGQIIFGGIDK + 3 Deamidated (NQ)
3595 564.0667 2252.2377 2252.2430 -2.34 1 2 0.95 +1Score > 34 indicates identity
Score > 14 indicates homology		 VRLVDNGAVAFIPASFLHAVR + Deamidated (NQ)
4306 1004.1930 3009.5572 3009.5456 3.85 1 2 0.81 +1Score > 35 indicates identity
Score > 13 indicates homology		 GIKTHAPNAFVICITNPLDAMVWALQK + 2 Deamidated (NQ)
4390 789.9173 3155.6401 3155.5889 16.2 1 2 0.87 +1Score > 35 indicates identity
Score > 14 indicates homology		 FFFQMSQPIPSYLIALAIGDLASAEVGPR + 2 Deamidated (NQ); Oxidation (M)
4163 937.4928 2809.4566 2809.4513 1.88 0 2 0.76 +1Score > 36 indicates identity
Score > 13 indicates homology		 QGWLLADNAFILRPWLMTPVQIPE + 2 Deamidated (NQ)
4180 943.1616 2826.4630 2826.4215 14.7 1 2 1 +1Score > 36 indicates identity
Score > 14 indicates homology		 IIESGIIINIGDGVANVYGLFNAIYGE + 3 Deamidated (NQ)
3088 650.3785 1948.1137 1948.1357 -11.3 0 2 0.94 +1Score > 31 indicates identity
Score > 14 indicates homology		 VLLGLSGGVDSSVVGVLLHK
4497 832.9270 3327.6789 3327.6890 -3.03 1 2 0.89 +1Score > 35 indicates identity
Score > 14 indicates homology		 SNNIVHLTLSDVVLSAMLRNSMHLVNFMR + Deamidated (NQ); Oxidation (M)
3650 766.7668 2297.2786 2297.2420 15.9 1 2 1 +1Score > 33 indicates identity
Score > 14 indicates homology		 KIAVYPGSFDPITNGHLDIIK
3818 606.0488 2420.1661 2420.1278 15.8 1 2 0.96 +1Score > 39 indicates identity
Score > 14 indicates homology		 NVEYVADLGCGPDNSTALLQQR + Deamidated (NQ)
3122 990.5425 1979.0704 1979.0544 8.13 1 2 1 +1Score > 36 indicates identity
Score > 14 indicates homology		 AGTATKMALNIISTAVMVR + 2 Oxidation (M)
4780 808.6542 6461.1754 6461.1349 6.26 1 2 0.8 +1Score > 27 indicates identity
Score > 13 indicates homology		 MSKPPVRVVAQPPPPHPQALSQQYHQQNPMMMYSAPNTRPHVIPTMQVQPTMAAQIK + 4 Deamidated (NQ); 3 Oxidation (M)
3938 850.0956 2547.2650 2547.2228 16.6 1 2 1 +1Score > 38 indicates identity
Score > 14 indicates homology		 ALNIGDILTVNIQINDKADFDNE + 3 Deamidated (NQ)
4293 998.4904 2992.4494 2992.4272 7.42 1 2 0.94 +1Score > 37 indicates identity
Score > 14 indicates homology		 IQINAFAEQTPVVMAPNMSVGVNLMWK + 5 Deamidated (NQ)
4151 936.5119 2806.5139 2806.4649 17.5 1 2 1 +1Score > 33 indicates identity
Score > 14 indicates homology		 TITALAIMMASFAANASVLPETPVPFK + Oxidation (M)
3723 470.0568 2345.2476 2345.2413 2.70 1 2 0.75 +1Score > 36 indicates identity
Score > 13 indicates homology		 QLTAMLDAAGIDYVINPRLVR + Deamidated (NQ); Oxidation (M)
3959 856.8146 2567.4220 2567.3832 15.1 1 2 1 +1Score > 32 indicates identity
Score > 14 indicates homology		 SSIINKININLQQQLSPILLALE + 6 Deamidated (NQ)
3610 756.3939 2266.1599 2266.1733 -5.91 1 2 0.98 +1Score > 38 indicates identity
Score > 14 indicates homology		 SSIFIQSGKDFLPSSGLLLQE + Deamidated (NQ)
3978 863.4467 2587.3183 2587.3311 -4.96 0 2 0.83 +1Score > 37 indicates identity
Score > 13 indicates homology		 TGSMIVNNLAGLMMLTSLFVISVK + Deamidated (NQ); 3 Oxidation (M)
4059 900.4614 2698.3624 2698.3313 11.5 1 2 0.81 +1Score > 37 indicates identity
Score > 13 indicates homology		 LLQLCSANLPVGGFSFSQGLEYAVE
4485 827.7108 3306.8141 3306.7890 7.59 0 2 1 +1Score > 30 indicates identity
Score > 14 indicates homology		 ISLGQLITYNALLVFFTEPLQNIINLQVK + 5 Deamidated (NQ)
2972 622.6769 1865.0089 1865.0081 0.44 1 2 1 +1Score > 37 indicates identity
Score > 14 indicates homology		 ANPITVPVALVDMEIQR
3436 1086.5577 2171.1008 2171.0602 18.7 1 2 0.94 +1Score > 39 indicates identity
Score > 14 indicates homology		 MEDLGMGALLAVNQGSVEPPK + Oxidation (M)
3989 873.0880 2616.2422 2616.2490 -2.60 1 2 0.98 +1Score > 38 indicates identity
Score > 14 indicates homology		 SLGQRHYDVQLIGGMVLNDGNIAE + 2 Deamidated (NQ); Oxidation (M)
3244 685.0489 2052.1249 2052.1152 4.72 0 2 1 +1Score > 35 indicates identity
Score > 14 indicates homology		 STFGVIGGVATLIMLLMWK + Oxidation (M)
3973 861.4531 2581.3375 2581.3500 -4.86 1 2 0.78 +1Score > 37 indicates identity
Score > 13 indicates homology		 LGLPDDGVNGLHILPEDAPVGTNIR
4039 895.7544 2684.2414 2684.2718 -11.3 1 2 0.76 +1Score > 37 indicates identity
Score > 13 indicates homology		 NAIFVSLNGPLYSGSYQGATPNRQE + 2 Deamidated (NQ)
4076 680.9022 2719.5797 2719.5384 15.2 1 2 1 +1Score > 26 indicates identity
Score > 14 indicates homology		 QINDLLASGWTINRLAKPDLVILR + Deamidated (NQ)
4739 1046.9110 5229.5186 5229.5479 -5.60 1 2 1 +1Score > 30 indicates identity
Score > 14 indicates homology		 VPGVDLYLQPTQDLTIDTQVSRTQYQFTLQATSLDALSTWVPQLME + 4 Deamidated (NQ); Oxidation (M)
4112 690.3864 2757.5165 2757.5137 1.01 1 2 1 +1Score > 32 indicates identity
Score > 14 indicates homology		 QTHRSILLGLLLGAGQSPQPDSSLIR + Deamidated (NQ)
4433 1070.2340 3207.6802 3207.7438 -19.8 1 2 1 +1Score > 34 indicates identity
Score > 14 indicates homology		 NAITLLMASGGSTNVVLHLLAIAHEAHVNIK + Deamidated (NQ)
Page: Previous 1 …22 23 24 25 26 27 28 29 30 31 32 … 38 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/