MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita4 sp
MS data file : PRT1270_T-BRSC_4_20250714120925.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 23:41:34 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,786

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 2501–2600 (out of 3754)

Page: Previous 1 …21 22 23 24 25 26 27 28 29 30 31 … 38 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3926 846.4345 2536.2817 2536.2665 5.97 0 3 0.88 +1Score > 38 indicates identity
Score > 15 indicates homology		 AMYAPPIGGQISCSSNITGLLLTR + Deamidated (NQ); Oxidation (M)
3187 1008.0057 2013.9968 2013.9677 14.5 1 3 1 +1Score > 40 indicates identity
Score > 15 indicates homology		 AANQPGVASPLVMASDAELR + 2 Deamidated (NQ); Oxidation (M)
4117 692.3423 2765.3401 2765.3503 -3.69 0 3 0.76 +1Score > 38 indicates identity
Score > 14 indicates homology		 IIMLGSGVDDNVANSIVAQMLFLQAE + 2 Deamidated (NQ); Oxidation (M)
2179 366.4665 1461.8369 1461.8079 19.9 0 3 0.95 +1Score > 35 indicates identity
Score > 15 indicates homology		 IIFSGNVSALQALK + 2 Deamidated (NQ)
2797 588.3251 1761.9535 1761.9223 17.7 1 3 0.64 +1Score > 37 indicates identity
Score > 13 indicates homology		 LVEFMTSGPVVVQVLE + Oxidation (M)
3791 802.7695 2405.2867 2405.2882 -0.64 1 3 1 +1Score > 35 indicates identity
Score > 15 indicates homology		 LAIIDYIPLLAQQLGVEFFNE
4109 689.6171 2754.4393 2754.4916 -19.0 1 3 0.65 +1Score > 36 indicates identity
Score > 13 indicates homology		 QAIVDKNPVVASAALVSGIHLLQANPE + Deamidated (NQ)
4185 711.3439 2841.3465 2841.3127 11.9 0 3 1 +1Score > 37 indicates identity
Score > 15 indicates homology		 HHTIQNSDDAYVQLDNLPGMSLVAGK + 3 Deamidated (NQ); Oxidation (M)
4710 876.4665 4377.2961 4377.2105 19.6 1 3 1 +1Score > 29 indicates identity
Score > 15 indicates homology		 SAMIYHLYNNGTPNLMLYILVLSVIDNYGSGIYVWPKK + 2 Deamidated (NQ); Oxidation (M)
3555 1119.0746 2236.1346 2236.1409 -2.80 1 3 0.99 +1Score > 39 indicates identity
Score > 15 indicates homology		 ASLTLGLTMRGIQIFQNLDE + Deamidated (NQ); Oxidation (M)
4348 770.8923 3079.5401 3079.4842 18.2 1 3 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 TMLACDLIRDGQVLHSYTSLNDVVVNK + 3 Deamidated (NQ); Oxidation (M)
3574 748.4196 2242.2370 2242.2685 -14.1 1 3 0.62 +1Score > 34 indicates identity
Score > 13 indicates homology		 IPSATLTAIFSDRQLINLIR + Deamidated (NQ)
4549 1149.9115 3446.7127 3446.6439 19.9 1 3 0.68 +1Score > 35 indicates identity
Score > 13 indicates homology		 VFQIYEQHADTVGIDAVLQPSAVSPSVADMLE + 2 Deamidated (NQ); Oxidation (M)
4563 1185.6149 3553.8229 3553.7657 16.1 1 3 1 +1Score > 34 indicates identity
Score > 15 indicates homology		 VDSHIMKVVQQIVHQAGAGHQIIVQNVTMDQE + 2 Deamidated (NQ)
342 614.3273 613.3200 613.3184 2.71 0 3 0.91 +1Score > 37 indicates identity
Score > 15 indicates homology		 AGPNGAK
3544 558.2562 2228.9957 2228.9895 2.76 1 3 1 +1Score > 37 indicates identity
Score > 15 indicates homology		 SPYHDACPATQQPSVIQAEK + 3 Deamidated (NQ)
3577 562.0582 2244.2037 2244.2286 -11.1 1 3 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 NLLLTTILADAINLGLTKMAE + Deamidated (NQ); Oxidation (M)
4257 732.8982 2927.5637 2927.5136 17.1 1 3 1 +1Score > 33 indicates identity
Score > 15 indicates homology		 MKLTINILFCLILISQYNSANGNLR + 3 Deamidated (NQ); Oxidation (M)
4354 772.4308 3085.6941 3085.6594 11.2 1 3 1 +1Score > 31 indicates identity
Score > 15 indicates homology		 TLVGAMAATGLGLQGKTVHSITINDYLAVR + Oxidation (M)
4030 892.0959 2673.2659 2673.2778 -4.47 1 3 0.76 +1Score > 38 indicates identity
Score > 14 indicates homology		 AHPIYLSEDNDQADQLVGAMVMLK + Oxidation (M)
4214 959.4961 2875.4665 2875.4814 -5.21 1 3 0.68 +1Score > 37 indicates identity
Score > 13 indicates homology		 NILVIKSSVFGDNGNSSALVNAQVDALK + 3 Deamidated (NQ)
4371 1040.5525 3118.6357 3118.6382 -0.81 1 3 0.65 +1Score > 34 indicates identity
Score > 13 indicates homology		 LKFVILVCSVACVFGAVVPGGMLPQLDGR + Deamidated (NQ); Oxidation (M)
4466 817.1553 3264.5921 3264.6428 -15.5 1 3 0.76 +1Score > 36 indicates identity
Score > 14 indicates homology		 AFIAGRALAGAANPAQVAGDFHAQIDAIWGGAR + 2 Deamidated (NQ)
4616 627.3374 3757.9807 3757.9654 4.07 1 3 1 +1Score > 32 indicates identity
Score > 15 indicates homology		 LGSVGKYIDDHNYPILGICVGAQFIALHFGASVVK
1956 674.9125 1347.8104 1347.7874 17.1 1 3 0.79 +1Score > 30 indicates identity
Score > 14 indicates homology		 VIDVLIEHALAR
4423 639.7239 3193.5831 3193.6079 -7.77 1 3 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 NFIVVSDPYPTVSAMAADLILPTAMWVEK + Oxidation (M)
3481 731.3865 2191.1377 2191.1637 -11.9 1 2 0.84 +1Score > 38 indicates identity
Score > 14 indicates homology		 QQFGRIINIASVNGLVGFAGK + 3 Deamidated (NQ)
745 411.2438 820.4730 820.4629 12.4 0 2 0.98 +1Score > 37 indicates identity
Score > 15 indicates homology		 LFALMAR
3699 1160.5839 2319.1532 2319.1702 -7.29 1 2 0.82 +1Score > 39 indicates identity
Score > 14 indicates homology		 AMLQDIAILTGGQVISEDLGMK + Deamidated (NQ); Oxidation (M)
4370 1040.5372 3118.5898 3118.6299 -12.9 1 2 1 +1Score > 35 indicates identity
Score > 15 indicates homology		 LGIPVVAILDSNSDPRGVTFPIPGNDDAIR + Deamidated (NQ)
3961 857.1500 2568.4282 2568.3985 11.6 1 2 1 +1Score > 31 indicates identity
Score > 15 indicates homology		 AAAQGLMAGINAVLALKNQDPFILK + 2 Deamidated (NQ)
4482 551.8102 3304.8175 3304.7998 5.36 0 2 0.86 +1Score > 30 indicates identity
Score > 14 indicates homology		 NNNIINLIAAIILSLSIIFGWQYFVVKPE + 3 Deamidated (NQ)
4489 662.5703 3307.8151 3307.7896 7.71 1 2 1 +1Score > 30 indicates identity
Score > 15 indicates homology		 YPPSIGSILLIIPIFLTFFGNSNAQLWKR + 3 Deamidated (NQ)
3985 870.1321 2607.3745 2607.4233 -18.7 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 ISDIILFGTLMVNAGAVLNFKLQK + 3 Deamidated (NQ)
3224 1019.9991 2037.9836 2037.9967 -6.39 1 2 1 +1Score > 40 indicates identity
Score > 15 indicates homology		 NAQAHLKDTQLQLDDAVR + 3 Deamidated (NQ)
3854 822.4465 2464.3177 2464.3425 -10.1 1 2 0.92 +1Score > 35 indicates identity
Score > 15 indicates homology		 NVVDIIEQLADNGIIVIVNGLDK + Deamidated (NQ)
4207 718.8917 2871.5377 2871.4841 18.7 0 2 0.99 +1Score > 34 indicates identity
Score > 15 indicates homology		 VLDAYGVPYTVLDPAGCIAAEPALAAVR
4525 677.9527 3384.7271 3384.7276 -0.13 1 2 0.97 +1Score > 34 indicates identity
Score > 15 indicates homology		 SIIDTMNTTLVQEVGALWSTVGAVVLGYGFAR + Deamidated (NQ); Oxidation (M)
3291 696.7090 2087.1052 2087.1449 -19.0 1 2 0.61 +1Score > 37 indicates identity
Score > 13 indicates homology		 RPMLPLIQALHQLGIEIE + Deamidated (NQ); Oxidation (M)
2580 820.9621 1639.9096 1639.9120 -1.41 1 2 0.84 +1Score > 37 indicates identity
Score > 14 indicates homology		 QLKHILMPIGNFTK + Deamidated (NQ)
3984 651.1192 2600.4477 2600.4248 8.82 1 2 0.72 +1Score > 31 indicates identity
Score > 13 indicates homology		 KIISGGVNNVLVMGIPDLSLTPYGK + Oxidation (M)
4116 922.1389 2763.3949 2763.4331 -13.8 1 2 0.94 +1Score > 37 indicates identity
Score > 15 indicates homology		 DQAFVSSLVPNYGGTLDIIGGVVVESK
4426 641.3640 3201.7836 3201.7301 16.7 1 2 1 +1Score > 29 indicates identity
Score > 15 indicates homology		 FFPPILKPMLPPNAFQGKVAFITGGGTGLGK + 2 Deamidated (NQ)
711 399.2364 796.4582 796.4443 17.5 0 2 0.77 +1Score > 36 indicates identity
Score > 14 indicates homology		 GAPAVTPGK
3080 647.3476 1939.0210 1939.0010 10.3 1 2 0.74 +1Score > 38 indicates identity
Score > 14 indicates homology		 AINQLQPLSNNDALKAAR + 3 Deamidated (NQ)
3799 805.1300 2412.3682 2412.3549 5.48 0 2 1 +1Score > 30 indicates identity
Score > 15 indicates homology		 LGISPIVTSSMLVQLLVGSQLIE + Oxidation (M)
2979 623.3763 1867.1071 1867.0778 15.7 1 2 1 +1Score > 27 indicates identity
Score > 15 indicates homology		 QLGIQQIKLVINSLGDK + Deamidated (NQ)
4133 927.8238 2780.4496 2780.4895 -14.4 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 SLQVTLNLGIGSRSVVHTPLMWLDK + Deamidated (NQ); Oxidation (M)
4492 830.4243 3317.6681 3317.6238 13.4 1 2 0.64 +1Score > 35 indicates identity
Score > 13 indicates homology		 MAQPSFFQSPPPTTLAAIAAAANATLVDASRGE + Deamidated (NQ); Oxidation (M)
3393 537.3047 2145.1897 2145.1980 -3.86 1 2 0.83 +1Score > 34 indicates identity
Score > 14 indicates homology		 MVLNRLAIFGITVDSAANLK
3690 463.8568 2314.2476 2314.2130 14.9 1 2 0.66 +1Score > 35 indicates identity
Score > 13 indicates homology		 MVVANPILVQADIDFLLGELE + Oxidation (M)
4190 949.8122 2846.4148 2846.4142 0.21 1 2 1 +1Score > 37 indicates identity
Score > 15 indicates homology		 LFFWQLNAILNMKLFAFYGDHLE + Deamidated (NQ); Oxidation (M)
3843 816.4258 2446.2556 2446.2236 13.1 0 2 0.62 +1Score > 38 indicates identity
Score > 13 indicates homology		 VPNAYAALAQLMQLVDSMKPQR + 3 Deamidated (NQ)
4547 1145.5811 3433.7215 3433.6713 14.6 1 2 0.79 +1Score > 35 indicates identity
Score > 14 indicates homology		 SNIVGKPMANLMLQKLDATNCTVTICHSATK + 2 Deamidated (NQ); Oxidation (M)
732 405.7281 809.4416 809.4508 -11.3 1 2 0.81 +1Score > 38 indicates identity
Score > 14 indicates homology		 AIDAHKR
2664 562.2976 1683.8710 1683.8905 -11.6 0 2 0.64 +1Score > 39 indicates identity
Score > 13 indicates homology		 LSPQLVAWALNIVME + Deamidated (NQ)
3527 738.0323 2211.0751 2211.0504 11.2 1 2 0.98 +1Score > 39 indicates identity
Score > 15 indicates homology		 ILLELLNQMDGFDQTTNVK + 4 Deamidated (NQ); Oxidation (M)
4118 922.8433 2765.5081 2765.4575 18.3 1 2 0.88 +1Score > 32 indicates identity
Score > 14 indicates homology		 VIIMADADVDGSHIRTLLLTFFFR + Oxidation (M)
4268 738.3771 2949.4793 2949.5059 -9.01 1 2 1 +1Score > 37 indicates identity
Score > 15 indicates homology		 VQTQGGYVPQRFMLPSVDTAIIWSVR + 2 Deamidated (NQ)
3742 787.7581 2360.2525 2360.2562 -1.58 1 2 0.85 +1Score > 36 indicates identity
Score > 14 indicates homology		 RNILPMTPVWAPVPNLNADLK + 2 Deamidated (NQ)
2268 752.4178 1502.8210 1502.8279 -4.55 1 2 0.8 +1Score > 38 indicates identity
Score > 14 indicates homology		 AYEPLIRIICQK
4011 882.0959 2643.2659 2643.3027 -13.9 1 2 0.99 +1Score > 38 indicates identity
Score > 15 indicates homology		 EVNGQPLAYLDSAASAQKPQAVIDR + 3 Deamidated (NQ)
1493 572.8658 1143.7170 1143.6975 17.1 1 2 0.79 +1Score > 27 indicates identity
Score > 14 indicates homology		 LSLNRTIVTK
2767 867.4937 1732.9728 1732.9433 17.0 1 2 0.96 +1Score > 34 indicates identity
Score > 15 indicates homology		 VVDVFLKQPIMNTTK + Deamidated (NQ)
3952 854.1245 2559.3517 2559.3167 13.7 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 TIDIDLKQINSQTLGLDSLNVQK + 4 Deamidated (NQ)
4405 635.7057 3173.4921 3173.5487 -17.8 1 2 0.95 +1Score > 36 indicates identity
Score > 15 indicates homology		 IMNQFVVFEDDMGYILPQIIPMGTITR + Deamidated (NQ); 2 Oxidation (M)
2364 776.4214 1550.8282 1550.8417 -8.65 0 2 0.93 +1Score > 39 indicates identity
Score > 14 indicates homology		 QVNIVGTSPPSLPSR
3806 806.4312 2416.2718 2416.2342 15.6 0 2 0.74 +1Score > 36 indicates identity
Score > 13 indicates homology		 MLAPTALIQGMGLGDSVALITDGR + Deamidated (NQ); Oxidation (M)
4202 956.5007 2866.4803 2866.4600 7.06 0 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 TNQFTHLPVSNILDDLDLLTQIDLE
4419 1064.2236 3189.6490 3189.6534 -1.40 1 2 1 +1Score > 35 indicates identity
Score > 15 indicates homology		 YILTEMSVQYAPVGILAWLMFVAVAFLE + Oxidation (M)
3225 680.3385 2037.9937 2038.0041 -5.10 1 2 0.62 +1Score > 40 indicates identity
Score > 13 indicates homology		 AKNLINDYVSNQTQGMIK + 2 Deamidated (NQ)
3433 543.5516 2170.1773 2170.1707 3.02 1 2 0.77 +1Score > 36 indicates identity
Score > 14 indicates homology		 LFLAPLPCTELSLGQQLLR + 2 Deamidated (NQ)
3998 877.4686 2629.3840 2629.3374 17.7 1 2 0.66 +1Score > 36 indicates identity
Score > 13 indicates homology		 LELQVVNPPGYDLSQDSSALIAAVK + 3 Deamidated (NQ)
3571 748.4149 2242.2229 2242.1917 13.9 1 2 0.89 +1Score > 35 indicates identity
Score > 14 indicates homology		 TRQQIQQLDTQLLTAISQR + 2 Deamidated (NQ)
3919 843.4267 2527.2583 2527.2338 9.68 1 2 0.83 +1Score > 38 indicates identity
Score > 14 indicates homology		 FLMQAFGLQLNMELQLAAQSLE + Deamidated (NQ); 2 Oxidation (M)
3731 784.0602 2349.1588 2349.1522 2.80 1 2 0.98 +1Score > 39 indicates identity
Score > 15 indicates homology		 EVTQQMVLNFLNGGAGVNVLAR + 4 Deamidated (NQ); Oxidation (M)
3774 796.3984 2386.1734 2386.1877 -6.00 0 2 0.64 +1Score > 39 indicates identity
Score > 13 indicates homology		 HSSQVAAVQQHVPSGGIGLNLQR + 4 Deamidated (NQ)
3795 803.4120 2407.2142 2407.2536 -16.4 1 2 1 +1Score > 38 indicates identity
Score > 15 indicates homology		 ALSKISPNFSIASAFGNVHGVYK + Deamidated (NQ)
4578 898.2409 3588.9345 3588.9365 -0.55 1 2 0.8 +1Score > 31 indicates identity
Score > 14 indicates homology		 QGIGLPITGFANKPSDIPDLIDMVGGAPLVVKLLE + 2 Deamidated (NQ)
3282 696.0176 2085.0310 2085.0565 -12.2 1 2 1 +1Score > 39 indicates identity
Score > 15 indicates homology		 LFVSNRFSASIQLVDTMR + 2 Deamidated (NQ)
4228 724.3698 2893.4501 2893.4506 -0.18 1 2 1 +1Score > 37 indicates identity
Score > 15 indicates homology		 LAYCLQKCNVPLFVQHDAAQLYLK + 2 Deamidated (NQ)
2894 604.9643 1811.8711 1811.8611 5.50 0 2 0.96 +1Score > 40 indicates identity
Score > 15 indicates homology		 STLMNILTGLYQANSGE + Deamidated (NQ)
3107 656.3427 1966.0063 1965.9904 8.08 1 2 0.75 +1Score > 39 indicates identity
Score > 13 indicates homology		 KFDTVIMGGGLAGLLCGLE + Oxidation (M)
4599 737.3773 3681.8501 3681.8064 11.9 1 2 1 +1Score > 34 indicates identity
Score > 15 indicates homology		 NNIPVLMALIGIWNNNFLNIHYDLIGYNFKE + 4 Deamidated (NQ); Oxidation (M)
3348 1061.0514 2120.0882 2120.0870 0.57 1 2 0.75 +1Score > 39 indicates identity
Score > 13 indicates homology		 RGALQAIDQMSLFRPLCK + Deamidated (NQ); Oxidation (M)
3502 551.2944 2201.1485 2201.1692 -9.39 1 2 1 +1Score > 38 indicates identity
Score > 15 indicates homology		 LTDQTGSLRNIALGFDILPR + 2 Deamidated (NQ)
4339 766.3973 3061.5601 3061.5358 7.94 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 QLVFNEILQAAYQLMVDVFGNYVIQK + 3 Deamidated (NQ); Oxidation (M)
3945 851.7858 2552.3356 2552.3090 10.4 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 LNSSVVRSQMLQNLFLINNAMK + Deamidated (NQ); 2 Oxidation (M)
3968 860.7991 2579.3755 2579.3451 11.8 0 2 0.7 +1Score > 35 indicates identity
Score > 13 indicates homology		 NAALPQLCAALLSAEPVTLLNMPR + Deamidated (NQ); Oxidation (M)
4452 1079.8972 3236.6698 3236.6131 17.5 1 2 0.76 +1Score > 34 indicates identity
Score > 13 indicates homology		 IMSMVAPSGPVYQAGTLSGNPLAMTAGIKTLE + 2 Oxidation (M)
4627 766.3820 3826.8736 3826.8578 4.14 1 2 0.79 +1Score > 34 indicates identity
Score > 14 indicates homology		 FSNQPVVIDNGSGVIKAGFAGQDPPSHIFQSLVGNPK + 6 Deamidated (NQ)
3022 634.0173 1899.0301 1899.0175 6.59 1 2 0.64 +1Score > 37 indicates identity
Score > 13 indicates homology		 EMVILFNLSGHGLLDLK + Deamidated (NQ)
3208 677.0082 2028.0028 2028.0024 0.16 0 2 0.86 +1Score > 40 indicates identity
Score > 14 indicates homology		 ATGNLPPRPVHPGAAAASSGAE + Deamidated (NQ)
2467 532.9815 1595.9227 1595.9359 -8.26 1 2 1 +1Score > 34 indicates identity
Score > 15 indicates homology		 IQALQLVVNAANSKK
2946 617.6105 1849.8097 1849.8305 -11.3 1 2 0.86 +1Score > 37 indicates identity
Score > 14 indicates homology		 DAQAALFSFYTCKDGR + Deamidated (NQ)
3351 708.0321 2121.0745 2121.0994 -11.7 1 2 0.64 +1Score > 39 indicates identity
Score > 13 indicates homology		 NQPIFLLEQLQSGLGSTFK + 2 Deamidated (NQ)
3441 1087.5482 2173.0818 2173.0547 12.5 1 2 0.76 +1Score > 39 indicates identity
Score > 13 indicates homology		 KFNASNLITCANFIGLMNK + 2 Deamidated (NQ); Oxidation (M)
3129 661.6886 1982.0440 1982.0473 -1.67 1 2 0.83 +1Score > 38 indicates identity
Score > 14 indicates homology		 QLLGAGFGSLGPVNLPEGVR + 2 Deamidated (NQ)
4310 1006.5734 3016.6984 3016.7253 -8.92 1 2 1 +1Score > 28 indicates identity
Score > 15 indicates homology		 VKTLSVPAFISGIFGVTEPAIYGVTLPLK
3572 748.4175 2242.2307 2242.2507 -8.95 1 2 1 +1Score > 34 indicates identity
Score > 15 indicates homology		 KPVLMYSIGKDSSVLLHLAR + Oxidation (M)
Page: Previous 1 …21 22 23 24 25 26 27 28 29 30 31 … 38 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/