| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | Rita4 sp |
| MS data file | : | PRT1270_T-BRSC_4_20250714120925.mgf |
| Database | : | SwissProt 57.15 (515,203 sequences; 181,334,896 residues) |
| Timestamp | : | 12 Aug 2025 at 23:41:34 GMT |
Not what you expected? Try
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | GluC_Trypsin |
| Fixed modifications | : | |
| Variable modifications | : | |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,786 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 | 2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | ||||
| 6.2e-007 | 1 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | ||||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle (
) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 735.9225 | 1469.8304 | 1469.8276 | 1.96 | 1 | 6 | 1 | 1Score > 37 indicates identityScore > 19 indicates homology |
AVNLNVPLVVRMK + 2 Deamidated (NQ); Oxidation (M) | |
| 620.3224 | 1857.9454 | 1857.9459 | -0.29 | 1 | 6 | 0.57 | 1Score > 40 indicates identityScore > 17 indicates homology |
DAVLDDVLSLTVEDILE | |
| 607.3388 | 1212.6630 | 1212.6601 | 2.40 | 1 | 6 | 0.53 | 1Score > 40 indicates identityScore > 16 indicates homology |
KPAELVLSDLE | |
| 649.3492 | 1296.6838 | 1296.6898 | -4.60 | 1 | 6 | 0.7 | 1Score > 39 indicates identityScore > 17 indicates homology |
NVTPNNNIRQK | |
| 567.2935 | 1698.8587 | 1698.8546 | 2.42 | 1 | 6 | 0.93 | 1Score > 40 indicates identityScore > 19 indicates homology |
RSVTSMALTVFQGMR + Oxidation (M) | |
| 735.3856 | 2203.1350 | 2203.0943 | 18.4 | 0 | 6 | 0.98 | 1Score > 38 indicates identityScore > 19 indicates homology |
VADQDVPPTSHPLPLTNVMR + Deamidated (NQ); Oxidation (M) | |
| 455.2306 | 1362.6700 | 1362.6528 | 12.6 | 1 | 6 | 0.91 | 1Score > 41 indicates identityScore > 19 indicates homology |
VGSAVGAAAGGEFDR | |
| 509.6397 | 1525.8973 | 1525.8716 | 16.9 | 1 | 6 | 1 | 1Score > 32 indicates identityScore > 19 indicates homology |
VVLSQVSLAISPGEK | |
| 411.2422 | 1230.7048 | 1230.6867 | 14.7 | 1 | 6 | 0.95 | 1Score > 37 indicates identityScore > 19 indicates homology |
RSIQMQTVLR | |
| 520.5437 | 2078.1457 | 2078.1385 | 3.47 | 1 | 6 | 0.96 | 1Score > 34 indicates identityScore > 19 indicates homology |
SHQLRVHSLALGHPIIGDK + Deamidated (NQ) | |
| 745.9308 | 1489.8470 | 1489.8286 | 12.4 | 1 | 6 | 0.41 | 1Score > 35 indicates identityScore > 15 indicates homology |
LINAMIGGSTKTLR + Oxidation (M) | |
| 403.2324 | 402.2251 | 402.2227 | 6.10 | 0 | 6 | 1 | 1Score > 50 indicates identityScore > 19 indicates homology |
AGGAK | |
| 615.6413 | 1843.9021 | 1843.8952 | 3.73 | 1 | 6 | 0.52 | 1Score > 40 indicates identityScore > 16 indicates homology |
LVILDEADNLHGTYDR + Deamidated (NQ) | |
| 524.7825 | 2095.1009 | 2095.0990 | 0.91 | 1 | 6 | 0.48 | 1Score > 38 indicates identityScore > 16 indicates homology |
WTEFLNLLGDTVVLNSFK | |
| 334.2121 | 666.4096 | 666.4177 | -12.1 | 1 | 6 | 0.76 | 1Score > 29 indicates identityScore > 18 indicates homology |
IPGPKR | |
| 610.8650 | 1219.7154 | 1219.7176 | -1.77 | 0 | 6 | 0.76 | 1Score > 34 indicates identityScore > 18 indicates homology |
LTTIYDIILR | |
| 424.5555 | 1270.6447 | 1270.6643 | -15.4 | 1 | 6 | 0.83 | 1Score > 41 indicates identityScore > 18 indicates homology |
NRHAAAHIPQR + Deamidated (NQ) | |
| 536.9345 | 1607.7817 | 1607.8042 | -14.0 | 1 | 6 | 0.69 | 1Score > 41 indicates identityScore > 17 indicates homology |
IKATYQDGTVIAQAE + Deamidated (NQ) | |
| 603.6464 | 1807.9174 | 1807.9455 | -15.5 | 1 | 6 | 0.93 | 1Score > 40 indicates identityScore > 19 indicates homology |
QPIPLQVLLSQEAQLE + 3 Deamidated (NQ) | |
| 718.3802 | 2152.1188 | 2152.1303 | -5.38 | 1 | 6 | 0.75 | 1Score > 38 indicates identityScore > 18 indicates homology |
LFGLAVLDITSGNFSVQEIK + 2 Deamidated (NQ) | |
| 931.4904 | 2791.4494 | 2791.4942 | -16.1 | 1 | 6 | 0.48 | 1Score > 36 indicates identityScore > 16 indicates homology |
AAIKQAAQDIGIVFAANFSVGVNVMLK + Deamidated (NQ); Oxidation (M) | |
| 687.1549 | 3430.7381 | 3430.7092 | 8.42 | 1 | 6 | 0.58 | 1Score > 35 indicates identityScore > 16 indicates homology |
TVTIFTVGTGGMFDQRLVGATNQPKPAQWHR + 2 Deamidated (NQ); Oxidation (M) | |
| 772.6244 | 3086.4685 | 3086.4689 | -0.13 | 0 | 6 | 0.67 | 1Score > 36 indicates identityScore > 17 indicates homology |
TMYDAQGIGLAASQVDHHIQLIVMDLSE + 2 Oxidation (M) | |
| 1055.5140 | 3163.5202 | 3163.4703 | 15.8 | 1 | 6 | 0.93 | 1Score > 36 indicates identityScore > 19 indicates homology |
QSEFLVCSGGGSYDSGAMALVVNHHGDIIK + Oxidation (M) | |
| 589.8141 | 1177.6136 | 1177.6091 | 3.82 | 1 | 6 | 0.61 | 1Score > 41 indicates identityScore > 17 indicates homology |
RGTAVTFLGQE | |
| 648.3539 | 1942.0399 | 1942.0047 | 18.1 | 1 | 6 | 0.48 | 1Score > 37 indicates identityScore > 16 indicates homology |
HKLLNGLDDIGITLQYE + Deamidated (NQ) | |
| 607.3354 | 1212.6562 | 1212.6615 | -4.33 | 0 | 6 | 1 | 1Score > 40 indicates identityScore > 19 indicates homology |
VFSNDIHLLR | |
| 631.6870 | 1892.0392 | 1892.0043 | 18.4 | 1 | 6 | 0.79 | 1Score > 35 indicates identityScore > 18 indicates homology |
RLSTYVGNLNVVLFAPE + Deamidated (NQ) | |
| 727.0833 | 2178.2281 | 2178.2082 | 9.13 | 0 | 6 | 0.93 | 1Score > 32 indicates identityScore > 18 indicates homology |
CNLSTVPGLALAQLPALVALR + 2 Deamidated (NQ) | |
| 547.7711 | 2187.0553 | 2187.0956 | -18.4 | 1 | 6 | 0.57 | 1Score > 39 indicates identityScore > 16 indicates homology |
DGSSKILFIYICPMQATVK + Deamidated (NQ); Oxidation (M) | |
| 365.2094 | 1092.6064 | 1092.5928 | 12.5 | 1 | 6 | 0.84 | 1Score > 37 indicates identityScore > 18 indicates homology |
RVGAVDVSYK | |
| 746.3871 | 1490.7596 | 1490.7763 | -11.1 | 1 | 6 | 1 | 1Score > 41 indicates identityScore > 19 indicates homology |
RNTIDIITLGCSK + Deamidated (NQ) | |
| 406.7163 | 1622.8361 | 1622.8450 | -5.52 | 1 | 6 | 0.84 | 1Score > 40 indicates identityScore > 18 indicates homology |
MSVLKQDGQFVVTR + Oxidation (M) | |
| 548.9673 | 1643.8801 | 1643.8817 | -1.01 | 1 | 6 | 0.83 | 1Score > 39 indicates identityScore > 18 indicates homology |
WKDKPVAMSIVQAR + Oxidation (M) | |
| 1076.5602 | 2151.1058 | 2151.0848 | 9.80 | 1 | 6 | 0.79 | 1Score > 38 indicates identityScore > 18 indicates homology |
KPHTTTVAPPQINFIKNNE + 3 Deamidated (NQ) | |
| 716.3818 | 2146.1236 | 2146.0874 | 16.8 | 1 | 6 | 0.88 | 1Score > 38 indicates identityScore > 18 indicates homology |
RTALNLLMHLSGIATMTNR + 2 Deamidated (NQ); 2 Oxidation (M) | |
| 720.4015 | 1438.7884 | 1438.8031 | -10.2 | 1 | 6 | 0.86 | 1Score > 38 indicates identityScore > 18 indicates homology |
ILQPLLEQGASLR + 2 Deamidated (NQ) | |
| 884.4470 | 1766.8794 | 1766.8951 | -8.88 | 0 | 6 | 0.92 | 1Score > 40 indicates identityScore > 18 indicates homology |
DAPQGTVILLFNAHDR + Deamidated (NQ) | |
| 758.4112 | 2272.2118 | 2272.2388 | -11.9 | 1 | 6 | 0.75 | 1Score > 36 indicates identityScore > 18 indicates homology |
KMLNVQSLDGLVPLLVAGFLE + Deamidated (NQ); Oxidation (M) | |
| 777.4147 | 2329.2223 | 2329.1835 | 16.6 | 1 | 6 | 1 | 1Score > 37 indicates identityScore > 19 indicates homology |
ARLDALTPAGMIAQIDLSITDE + Oxidation (M) | |
| 712.8293 | 1423.6440 | 1423.6328 | 7.91 | 1 | 6 | 0.97 | 1Score > 40 indicates identityScore > 19 indicates homology |
QRDDAVTDGGYAR + Deamidated (NQ) | |
| 409.9789 | 1635.8865 | 1635.8944 | -4.82 | 1 | 6 | 0.78 | 1Score > 37 indicates identityScore > 18 indicates homology |
HIDQISNVLAQIKR + 2 Deamidated (NQ) | |
| 885.0142 | 1768.0138 | 1767.9995 | 8.10 | 1 | 6 | 0.79 | 1Score > 32 indicates identityScore > 18 indicates homology |
LNAASASFQPVRALPVK | |
| 704.3696 | 2110.0870 | 2110.0921 | -2.43 | 1 | 6 | 0.55 | 1Score > 38 indicates identityScore > 16 indicates homology |
LLFNDIIFRMPNPNYVK + Deamidated (NQ); Oxidation (M) | |
| 919.4433 | 1836.8720 | 1836.8927 | -11.3 | 1 | 6 | 0.8 | 1Score > 40 indicates identityScore > 18 indicates homology |
NMNTSKFLALTPQLDE + Oxidation (M) | |
| 728.0606 | 2181.1600 | 2181.1641 | -1.88 | 1 | 6 | 0.8 | 1Score > 37 indicates identityScore > 18 indicates homology |
ATTPLTAATSNPSTPAKPAKQK + Deamidated (NQ) | |
| 379.8909 | 1136.6509 | 1136.6441 | 5.95 | 0 | 6 | 0.79 | 1Score > 36 indicates identityScore > 18 indicates homology |
SIASTIASIFK | |
| 773.4547 | 2317.3423 | 2317.3270 | 6.59 | 1 | 6 | 0.32 | 1Score > 28 indicates identityScore > 14 indicates homology |
ILNIPKLGSVNVHGSILPQYR | |
| 825.9337 | 1649.8528 | 1649.8739 | -12.7 | 1 | 6 | 0.84 | 1Score > 40 indicates identityScore > 18 indicates homology |
SLDTPMEFLPLFLK | |
| 609.3378 | 1824.9916 | 1824.9655 | 14.3 | 1 | 6 | 0.94 | 1Score > 37 indicates identityScore > 18 indicates homology |
ISLSNVMVDGVQLPPKE | |
| 1038.5308 | 2075.0470 | 2075.0139 | 16.0 | 1 | 6 | 0.78 | 1Score > 39 indicates identityScore > 18 indicates homology |
IAALQEMAQSGMNVSTGPVR + Oxidation (M) | |
| 654.9877 | 1961.9413 | 1961.9233 | 9.15 | 1 | 6 | 0.95 | 1Score > 40 indicates identityScore > 18 indicates homology |
AWLITFGTWMYSVNKE + Deamidated (NQ); Oxidation (M) | |
| 724.8967 | 2895.5577 | 2895.5779 | -6.99 | 0 | 6 | 0.9 | 1Score > 33 indicates identityScore > 18 indicates homology |
LANLNADIMVVVAYGLLLPQAVLDTPR + Deamidated (NQ); Oxidation (M) | |
| 645.8130 | 2579.2229 | 2579.2173 | 2.16 | 1 | 6 | 0.64 | 1Score > 38 indicates identityScore > 17 indicates homology |
RIMDLADSGSGAVAANSSAAPVFLNE + Deamidated (NQ); Oxidation (M) | |
| 919.4965 | 918.4892 | 918.4957 | -7.00 | 1 | 6 | 0.74 | 1Score > 41 indicates identityScore > 17 indicates homology |
KNLQLMR + Deamidated (NQ); Oxidation (M) | |
| 1159.7125 | 1158.7052 | 1158.6860 | 16.6 | 0 | 6 | 0.96 | 1Score > 31 indicates identityScore > 18 indicates homology |
ILDTVISSIAK | |
| 1068.5625 | 2135.1104 | 2135.0858 | 11.5 | 1 | 6 | 0.79 | 1Score > 38 indicates identityScore > 18 indicates homology |
ILLSLDNQDLEINQVNHR + 2 Deamidated (NQ) | |
| 828.4850 | 1654.9554 | 1654.9519 | 2.17 | 1 | 6 | 0.4 | 1Score > 33 indicates identityScore > 15 indicates homology |
RIIQVHSLVVKPHE + Deamidated (NQ) | |
| 477.6046 | 1429.7920 | 1429.7929 | -0.63 | 1 | 6 | 0.93 | 1Score > 38 indicates identityScore > 18 indicates homology |
KNIPLNNGVYAVK + Deamidated (NQ) | |
| 636.6174 | 1906.8304 | 1906.8037 | 14.0 | 1 | 6 | 0.94 | 1Score > 37 indicates identityScore > 18 indicates homology |
NMVDPQNGKGSLCSQAAE + 2 Deamidated (NQ) | |
| 647.3423 | 1292.6700 | 1292.6473 | 17.6 | 0 | 6 | 0.97 | 1Score > 41 indicates identityScore > 18 indicates homology |
HLQANPANIASR + 2 Deamidated (NQ) | |
| 429.2128 | 1712.8221 | 1712.8481 | -15.2 | 1 | 6 | 0.66 | 1Score > 40 indicates identityScore > 17 indicates homology |
LIQYHKISNNDPNR + 2 Deamidated (NQ) | |
| 648.3373 | 1941.9901 | 1941.9778 | 6.33 | 0 | 6 | 0.8 | 1Score > 39 indicates identityScore > 18 indicates homology |
QMATALAHCHQHGLVLR | |
| 576.6675 | 1726.9807 | 1726.9505 | 17.5 | 1 | 6 | 0.72 | 1Score > 35 indicates identityScore > 17 indicates homology |
ASDLKILPGLFGLSAPE | |
| 735.3853 | 2203.1341 | 2203.1194 | 6.65 | 1 | 6 | 0.49 | 1Score > 38 indicates identityScore > 15 indicates homology |
IMDYSLLLGIHVLNSNVRE + 2 Deamidated (NQ); Oxidation (M) | |
| 746.0882 | 2235.2428 | 2235.2449 | -0.96 | 1 | 6 | 0.84 | 1Score > 33 indicates identityScore > 18 indicates homology |
LTPPPVKIAAMAHNLPVLQPE | |
| 746.7275 | 2237.1607 | 2237.1587 | 0.90 | 1 | 6 | 1 | 1Score > 38 indicates identityScore > 19 indicates homology |
GLTPSQIGVMLRDSHGVAQVR + Deamidated (NQ); Oxidation (M) | |
| 947.4999 | 1892.9852 | 1892.9731 | 6.43 | 1 | 6 | 0.63 | 1Score > 39 indicates identityScore > 17 indicates homology |
NFNVSVNILQGKISQTK + 4 Deamidated (NQ) | |
| 761.4066 | 2281.1980 | 2281.1624 | 15.6 | 1 | 6 | 1 | 1Score > 37 indicates identityScore > 19 indicates homology |
HQVLQSQGVLILQGSMLEVGE + Deamidated (NQ); Oxidation (M) | |
| 380.2355 | 1137.6847 | 1137.6771 | 6.68 | 1 | 6 | 0.74 | 1Score > 32 indicates identityScore > 17 indicates homology |
LGLPIAGRWR | |
| 715.8731 | 1429.7316 | 1429.7412 | -6.71 | 1 | 6 | 0.78 | 1Score > 41 indicates identityScore > 18 indicates homology |
INTNGTLQTPNKK + 2 Deamidated (NQ) | |
| 806.7614 | 2417.2624 | 2417.2161 | 19.1 | 1 | 6 | 0.97 | 1Score > 37 indicates identityScore > 18 indicates homology |
QAALNAMPLVKPDQVRTPWHE + Deamidated (NQ); Oxidation (M) | |
| 587.0005 | 1757.9797 | 1757.9676 | 6.88 | 1 | 6 | 0.98 | 1Score > 35 indicates identityScore > 18 indicates homology |
NQVPFNAKGTVIVTIR + 2 Deamidated (NQ) | |
| 848.9326 | 1695.8506 | 1695.8203 | 17.9 | 1 | 6 | 0.96 | 1Score > 40 indicates identityScore > 18 indicates homology |
SQVEYAQSLAQTLQK + 3 Deamidated (NQ) | |
| 674.3522 | 2020.0348 | 2020.0153 | 9.63 | 0 | 6 | 0.71 | 1Score > 39 indicates identityScore > 17 indicates homology |
QVAFASTNIIPGLDFSPDK + Deamidated (NQ) | |
| 908.9653 | 1815.9160 | 1815.9400 | -13.2 | 1 | 6 | 0.87 | 1Score > 40 indicates identityScore > 18 indicates homology |
VVTLDMLDLGAARANLE + Oxidation (M) | |
| 873.0904 | 2616.2494 | 2616.2402 | 3.49 | 0 | 6 | 0.43 | 1Score > 38 indicates identityScore > 15 indicates homology |
LSVQDQPSLSPTSLQNSSSHTTTAK + 3 Deamidated (NQ) | |
| 397.7243 | 1586.8681 | 1586.8701 | -1.29 | 1 | 6 | 0.89 | 1Score > 38 indicates identityScore > 18 indicates homology |
MSILLIDLSGQELR | |
| 402.7379 | 1606.9225 | 1606.9519 | -18.3 | 1 | 6 | 0.88 | 1Score > 33 indicates identityScore > 18 indicates homology |
VPGAGPRGSLTLTLLR | |
| 672.0704 | 2684.2525 | 2684.2606 | -3.02 | 1 | 6 | 1 | 1Score > 37 indicates identityScore > 19 indicates homology |
KFISITVDGVTYNATPNTHSNFQE + 2 Deamidated (NQ) | |
| 498.9250 | 1493.7532 | 1493.7586 | -3.66 | 1 | 6 | 0.68 | 1Score > 41 indicates identityScore > 17 indicates homology |
TGTLAPRQGNPEPR + Deamidated (NQ) | |
| 710.3898 | 1418.7650 | 1418.7657 | -0.43 | 1 | 6 | 0.71 | 1Score > 40 indicates identityScore > 17 indicates homology |
NIGFKGSLINLIE + 2 Deamidated (NQ) | |
| 601.2753 | 1800.8041 | 1800.8101 | -3.35 | 1 | 6 | 0.59 | 1Score > 38 indicates identityScore > 16 indicates homology |
TDFVARNDAFQDMVR + Deamidated (NQ); Oxidation (M) | |
| 780.7208 | 2339.1406 | 2339.1604 | -8.50 | 1 | 6 | 0.43 | 1Score > 39 indicates identityScore > 15 indicates homology |
QNLLQAAGNVGQASGELLQQIGE + 2 Deamidated (NQ) | |
| 701.9005 | 1401.7864 | 1401.8014 | -10.6 | 1 | 6 | 0.86 | 1Score > 37 indicates identityScore > 18 indicates homology |
TMLSRLVISPTGK | |
| 692.7173 | 2075.1301 | 2075.0899 | 19.4 | 1 | 6 | 0.5 | 1Score > 36 indicates identityScore > 15 indicates homology |
ATDLDVFLKGGAALDINSVR + Deamidated (NQ) | |
| 538.3223 | 1611.9451 | 1611.9433 | 1.07 | 1 | 6 | 0.67 | 1Score > 32 indicates identityScore > 17 indicates homology |
RPKPPGPQLGRPRR + Deamidated (NQ) | |
| 862.4715 | 1722.9284 | 1722.9239 | 2.62 | 1 | 6 | 0.72 | 1Score > 38 indicates identityScore > 17 indicates homology |
RPLKDISFGQFLMR + Oxidation (M) | |
| 835.4435 | 834.4362 | 834.4487 | -15.0 | 0 | 6 | 0.3 | 1Score > 42 indicates identityScore > 13 indicates homology |
AGVLLAYE | |
| 804.8961 | 1607.7776 | 1607.7535 | 15.0 | 0 | 6 | 0.94 | 1Score > 41 indicates identityScore > 18 indicates homology |
LDADLAGAMMGINGVK + Deamidated (NQ); 2 Oxidation (M) | |
| 1012.0270 | 2022.0394 | 2022.0746 | -17.4 | 1 | 6 | 0.59 | 1Score > 39 indicates identityScore > 16 indicates homology |
LGGGPGAGDLQTLALEVAQQK | |
| 465.7139 | 1858.8265 | 1858.8632 | -19.7 | 1 | 6 | 0.94 | 1Score > 38 indicates identityScore > 18 indicates homology |
SLMDHLGSGKNWDLNR + Deamidated (NQ); Oxidation (M) | |
| 818.7513 | 2453.2321 | 2453.2261 | 2.44 | 1 | 6 | 0.6 | 1Score > 38 indicates identityScore > 16 indicates homology |
GGADVIELGIPFSDPMADGPVIQR | |
| 782.3890 | 1562.7634 | 1562.7763 | -8.20 | 1 | 6 | 0.61 | 1Score > 41 indicates identityScore > 16 indicates homology |
VNEAIPMPLGHGALE + Oxidation (M) | |
| 440.2636 | 1317.7690 | 1317.7768 | -5.96 | 1 | 6 | 0.88 | 1Score > 33 indicates identityScore > 18 indicates homology |
LAAIKSLVNYAR | |
| 825.9361 | 1649.8576 | 1649.8737 | -9.70 | 1 | 6 | 0.87 | 1Score > 40 indicates identityScore > 18 indicates homology |
DLIAANHVVEQTIAR + Deamidated (NQ) | |
| 574.3112 | 2293.2157 | 2293.2165 | -0.37 | 1 | 6 | 1 | 1Score > 37 indicates identityScore > 18 indicates homology |
IDASQTPDLVPTLAVLGAVAEGR + Deamidated (NQ) | |
| 898.4689 | 2692.3849 | 2692.3895 | -1.71 | 1 | 6 | 0.38 | 1Score > 37 indicates identityScore > 14 indicates homology |
TMGKIFGFLGLTTGVILHDLDSDAR + Oxidation (M) | |
| 702.8949 | 2807.5505 | 2807.5605 | -3.57 | 1 | 6 | 0.41 | 1Score > 31 indicates identityScore > 15 indicates homology |
LSNLQAMLPILEAVVQTSKPLVIISE + 2 Deamidated (NQ) | |
| 702.8949 | 2807.5505 | 2807.5581 | -2.69 | 0 | 6 | 0.95 | 1Score > 31 indicates identityScore > 18 indicates homology |
SLGQFLLQILGMLSGVGIMLLIALYE + Oxidation (M) |
Not what you expected? Try
the select summary.