MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | Rita4 sp |
| MS data file | : | PRT1270_T-BRSC_4_20250714120925.mgf |
| Database | : | SwissProt 57.15 (515,203 sequences; 181,334,896 residues) |
| Timestamp | : | 12 Aug 2025 at 23:41:34 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | GluC_Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,786 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
1| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | EFTU2_PSEPK | 1194 | Elongation factor Tu-B OS=Pseudomonas putida (strain KT2440) GN=tufB PE=3 SV=1 | |
| 3 | EFTU_CARRP | 163 | Elongation factor Tu OS=Carsonella ruddii (strain PV) GN=tuf PE=3 SV=1 | |
| 2 | EFTU1_PSEPK | 1113 | Elongation factor Tu-A OS=Pseudomonas putida (strain KT2440) GN=tufA PE=3 SV=1 | |
2| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | ATPB_PSEPG | 941 | ATP synthase subunit beta OS=Pseudomonas putida (strain GB-1) GN=atpD PE=3 SV=1 | |
| 2 | ATPB_PSESM | 569 | ATP synthase subunit beta OS=Pseudomonas syringae pv. tomato GN=atpD PE=3 SV=1 | |
42 peptide matches (23 non-duplicate, 19 duplicate)| Query | Dupes | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | U | 1 | 2 | Peptide |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Query | Dupes | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | U | 1 | 2 | Peptide |
| 337 |
1 |
305.1849 | 608.3552 | 608.3533 | 3.12 | 0 | 10 | 0.58 | 1Score > 31 indicates identity Score > 20 indicates homology |
|
|
K.YVSLK.D | |
| 693 |
1 |
395.7018 | 789.3890 | 789.3868 | 2.80 | 0 | 24 | 1.4 | 2Score > 43 indicates identity Score > 38 indicates homology |
|
|
K.DSNVLDK.V | |
| 1084 |
3 |
481.2809 | 960.5472 | 960.5393 | 8.28 | 0 | 66 | 0.00012 | 1Score > 39 indicates identity |
U | |
|
K.VGLFGGAGVGK.T |
| 1087 |
2 |
481.7764 | 961.5382 | 961.5345 | 3.88 | 0 | 32 | 0.1 | 1Score > 39 indicates identity Score > 35 indicates homology |
U | |
|
R.GVQYVLQR.Y |
| 1088 |
962.5459 | 961.5386 | 961.5345 | 4.27 | 0 | 34 | 0.15 | 2Score > 39 indicates identity Score > 39 indicates homology |
U | |
|
R.GVQYVLQR.Y | |
| 1430 |
561.3224 | 1120.6302 | 1120.6128 | 15.5 | 0 | 20 | 0.07 | 1Score > 38 indicates identity Score > 21 indicates homology |
U | |
K.DTIAGFSGILK.G | ||
| 1459 |
1 |
567.3195 | 1132.6244 | 1132.6162 | 7.30 | 1 | 19 | 0.49 | 1Score > 39 indicates identity Score > 28 indicates homology |
U | |
|
R.VALTGLTMAEK.F |
| 1528 |
581.3289 | 1160.6432 | 1160.6264 | 14.5 | 0 | 26 | 0.022 | 1Score > 39 indicates identity Score > 22 indicates homology |
U | |
|
K.VIDLVCPFAK.G | |
| 1638 |
1 |
602.8383 | 1203.6620 | 1203.6499 | 10.1 | 0 | 27 | 0.045 | 1Score > 39 indicates identity Score > 26 indicates homology |
U | |
R.DVVPSVYNALK.V | |
| 2156 |
484.2731 | 1449.7975 | 1449.7827 | 10.2 | 1 | 81 | 1.4e-007 | 1Score > 38 indicates identity Score > 25 indicates homology |
U | |
|
R.YTLAGTEVSALLGR.M | |
| 2157 |
2 |
725.9079 | 1449.8012 | 1449.7827 | 12.8 | 1 | 99 | 2.3e-009 | 1Score > 37 indicates identity Score > 25 indicates homology |
U | |
|
R.YTLAGTEVSALLGR.M |
| 2470 |
533.3040 | 1596.8902 | 1596.8723 | 11.2 | 0 | 39 | 0.028 | 1Score > 37 indicates identity Score > 36 indicates homology |
U | |
R.GLDVVDTGAAISVPVGK.A | ||
| 2472 |
2 |
799.4532 | 1596.8918 | 1596.8723 | 12.2 | 0 | 113 | 1.4e-009 | 1Score > 37 indicates identity |
U | |
R.GLDVVDTGAAISVPVGK.A | |
| 2633 |
557.0013 | 1667.9821 | 1667.9610 | 12.6 | 1 | 60 | 5.9e-005 | 1Score > 31 indicates identity |
U | |
|
R.IVQIIGAVIDVEFPR.D | |
| 2634 |
3 |
834.9993 | 1667.9840 | 1667.9610 | 13.8 | 1 | 101 | 4.3e-009 | 1Score > 30 indicates identity |
U | |
|
R.IVQIIGAVIDVEFPR.D |
| 2717 |
1 |
571.3332 | 1710.9778 | 1710.9556 | 13.0 | 1 | 52 | 0.00046 | 1Score > 34 indicates identity Score > 31 indicates homology |
U | |
K.YVSLKDTIAGFSGILK.G | |
| 2951 |
619.3053 | 1854.8941 | 1854.8860 | 4.33 | 1 | 26 | 0.46 | 1Score > 40 indicates identity Score > 35 indicates homology |
U | |
R.QLDPNVIGQEHYDTAR.G | ||
| 2955 |
928.9550 | 1855.8954 | 1855.8700 | 13.7 | 1 | 43 | 0.028 | 1Score > 40 indicates identity |
U | |
R.QLDPNVIGQEHYDTAR.G + Deamidated (NQ) | ||
| 2956 |
619.6409 | 1855.9009 | 1855.8700 | 16.6 | 1 | 21 | 0.14 | 1Score > 40 indicates identity Score > 25 indicates homology |
U | |
R.QLDPNVIGQEHYDTAR.G + Deamidated (NQ) | ||
| 3096 |
979.5202 | 1957.0258 | 1956.9986 | 13.9 | 1 | 82 | 1.9e-006 | 1Score > 38 indicates identity Score > 37 indicates homology |
U | |
R.FLSQPFFVAEVFTGSPGK.Y | ||
| 3826 |
2 |
813.0854 | 2436.2344 | 2436.1921 | 17.3 | 1 | 81 | 8.8e-008 | 1Score > 38 indicates identity Score > 23 indicates homology |
U | |
R.GIHQPAPSFADQAGGNDLLETGIK.V + Deamidated (NQ) | |
| 4630 |
961.9965 | 3843.9569 | 3843.9055 | 13.4 | 1 | 38 | 0.018 | 1Score > 33 indicates identity |
U | |
K.EGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSR.D + Deamidated (NQ) | ||
| 4630 |
961.9965 | 3843.9569 | 3843.9055 | 13.4 | 0 | 35 | 0.04 | 2Score > 33 indicates identity |
U | |
K.NGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSR.D + 2 Deamidated (NQ) |
22 subsets and intersections (602 subset proteins in total)3| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | ATPA_PSEPK | 882 | ATP synthase subunit alpha OS=Pseudomonas putida (strain KT2440) GN=atpA PE=3 SV=1 | |
| 3 | ATPA_RICAH | 169 | ATP synthase subunit alpha OS=Rickettsia akari (strain Hartford) GN=atpA PE=3 SV=1 | |
| 2 | ATPA_VEREI | 206 | ATP synthase subunit alpha OS=Verminephrobacter eiseniae (strain EF01-2) GN=atpA PE=3 SV=1 | |
4| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | CH60_PSEPK | 450 | 60 kDa chaperonin OS=Pseudomonas putida (strain KT2440) GN=groL PE=3 SV=1 | |
| 3 | CH602_SORC5 | 70 | 60 kDa chaperonin 2 OS=Sorangium cellulosum (strain So ce56) GN=groL2 PE=3 SV=1 | |
| 2 | CH601_ECOK1 | 115 | 60 kDa chaperonin 1 OS=Escherichia coli O1:K1 / APEC GN=groL1 PE=3 SV=1 | |
5| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | RL1_PSEE4 | 402 | 50S ribosomal protein L1 OS=Pseudomonas entomophila (strain L48) GN=rplA PE=3 SV=1 |
6| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | RPOC_PSEPK | 364 | DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida (strain KT2440) GN=rpoC PE=3 SV=1 |
7| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | DBHB_PSEAE | 308 | DNA-binding protein HU-beta OS=Pseudomonas aeruginosa GN=hupB PE=1 SV=3 |
8| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | PORF_PSESY | 290 | Outer membrane porin F OS=Pseudomonas syringae pv. syringae GN=oprF PE=3 SV=1 | |
| 2 | PORF_PSEAE | 78 | Outer membrane porin F OS=Pseudomonas aeruginosa GN=oprF PE=1 SV=1 | |
9| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | RL4_PSEP1 | 287 | 50S ribosomal protein L4 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rplD PE=3 SV=1 | |
| 2 | RL4_PSE14 | 192 | 50S ribosomal protein L4 OS=Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6) GN=rplD PE=3 SV=1 | |
10| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | OTCC_PSEPK | 280 | Ornithine carbamoyltransferase, catabolic OS=Pseudomonas putida (strain KT2440) GN=arcB PE=3 SV=3 |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/