MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita4 sp
MS data file : PRT1270_T-BRSC_4_20250714120925.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 23:41:34 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,786

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 1–10 (out of 182)


Page: 1 2 3 4 5 6  19 Next 

+1

Accession Score Description
Family member distances as a dendrogram 1 EFTU2_PSEPK 1194 Elongation factor Tu-B OS=Pseudomonas putida (strain KT2440) GN=tufB PE=3 SV=1
3 EFTU_CARRP 163 Elongation factor Tu OS=Carsonella ruddii (strain PV) GN=tuf PE=3 SV=1
2 EFTU1_PSEPK 1113 Elongation factor Tu-A OS=Pseudomonas putida (strain KT2440) GN=tufA PE=3 SV=1

-2

Accession Score Description
Family member distances as a dendrogram 1 ATPB_PSEPG 941 ATP synthase subunit beta OS=Pseudomonas putida (strain GB-1) GN=atpD PE=3 SV=1
2 ATPB_PSESM 569 ATP synthase subunit beta OS=Pseudomonas syringae pv. tomato GN=atpD PE=3 SV=1
Cut threshold

Score Mass Matches Sequences emPAI
ATPB_PSEPG 941 49415 38 (25) 15 (10) 0.80
ATP synthase subunit beta OS=Pseudomonas putida (strain GB-1) GN=atpD PE=3 SV=1
2 samesets of ATPB_PSEPG
ATPB_PSEPK 941 49385 38 (25) 15 (10) 0.80
ATP synthase subunit beta OS=Pseudomonas putida (strain KT2440) GN=atpD PE=3 SV=1
ATPB_PSEP1 941 49385 38 (25) 15 (10) 0.80
ATP synthase subunit beta OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=atpD PE=3 SV=1
ATPB_PSESM 569 49518 28 (16) 10 (6) 0.44
ATP synthase subunit beta OS=Pseudomonas syringae pv. tomato GN=atpD PE=3 SV=1
1 sameset of ATPB_PSESM
ATPB_PSEU2 569 49518 28 (16) 10 (6) 0.44
ATP synthase subunit beta OS=Pseudomonas syringae pv. syringae (strain B728a) GN=atpD PE=3 SV=1

-42 peptide matches (23 non-duplicate, 19 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U 1 2 Peptide
Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U 1 2 Peptide
337 +1 305.1849 608.3552 608.3533 3.12 0 10 0.58 +1Score > 31 indicates identity
Score > 20 indicates homology
X X K.YVSLK.D
693 +1 395.7018 789.3890 789.3868 2.80 0 24 1.4 +2Score > 43 indicates identity
Score > 38 indicates homology
X X K.DSNVLDK.V
1084 +3 481.2809 960.5472 960.5393 8.28 0 66 0.00012 +1Score > 39 indicates identity U X X K.VGLFGGAGVGK.T
1087 +2 481.7764 961.5382 961.5345 3.88 0 32 0.1 +1Score > 39 indicates identity
Score > 35 indicates homology
U X X R.GVQYVLQR.Y
1088   962.5459 961.5386 961.5345 4.27 0 34 0.15 +2Score > 39 indicates identity
Score > 39 indicates homology
U X X R.GVQYVLQR.Y
1430   561.3224 1120.6302 1120.6128 15.5 0 20 0.07 +1Score > 38 indicates identity
Score > 21 indicates homology
U X K.DTIAGFSGILK.G
1459 +1 567.3195 1132.6244 1132.6162 7.30 1 19 0.49 +1Score > 39 indicates identity
Score > 28 indicates homology
U X X R.VALTGLTMAEK.F
1528   581.3289 1160.6432 1160.6264 14.5 0 26 0.022 +1Score > 39 indicates identity
Score > 22 indicates homology
U X X K.VIDLVCPFAK.G
1638 +1 602.8383 1203.6620 1203.6499 10.1 0 27 0.045 +1Score > 39 indicates identity
Score > 26 indicates homology
U X R.DVVPSVYNALK.V
2156   484.2731 1449.7975 1449.7827 10.2 1 81 1.4e-007 +1Score > 38 indicates identity
Score > 25 indicates homology
U X X R.YTLAGTEVSALLGR.M
2157 +2 725.9079 1449.8012 1449.7827 12.8 1 99 2.3e-009 +1Score > 37 indicates identity
Score > 25 indicates homology
U X X R.YTLAGTEVSALLGR.M
2470   533.3040 1596.8902 1596.8723 11.2 0 39 0.028 +1Score > 37 indicates identity
Score > 36 indicates homology
U X R.GLDVVDTGAAISVPVGK.A
2472 +2 799.4532 1596.8918 1596.8723 12.2 0 113 1.4e-009 +1Score > 37 indicates identity U X R.GLDVVDTGAAISVPVGK.A
2633   557.0013 1667.9821 1667.9610 12.6 1 60 5.9e-005 +1Score > 31 indicates identity U X X R.IVQIIGAVIDVEFPR.D
2634 +3 834.9993 1667.9840 1667.9610 13.8 1 101 4.3e-009 +1Score > 30 indicates identity U X X R.IVQIIGAVIDVEFPR.D
2717 +1 571.3332 1710.9778 1710.9556 13.0 1 52 0.00046 +1Score > 34 indicates identity
Score > 31 indicates homology
U X K.YVSLKDTIAGFSGILK.G
2951   619.3053 1854.8941 1854.8860 4.33 1 26 0.46 +1Score > 40 indicates identity
Score > 35 indicates homology
U X R.QLDPNVIGQEHYDTAR.G
2955   928.9550 1855.8954 1855.8700 13.7 1 43 0.028 +1Score > 40 indicates identity U X R.QLDPNVIGQEHYDTAR.G + Deamidated (NQ)
2956   619.6409 1855.9009 1855.8700 16.6 1 21 0.14 +1Score > 40 indicates identity
Score > 25 indicates homology
U X R.QLDPNVIGQEHYDTAR.G + Deamidated (NQ)
D:\Xcalibur\Data\Jennifer\PRT1270 Rita DDA\PRT1270_T-BRSC_4_20250714120925.raw

Score > 38 indicates identity

Score > 37 indicates homology

3096   979.5202 1957.0258 1956.9986 13.9 1 82 1.9e-006 -1Score > 38 indicates identity
Score > 37 indicates homology
U X R.FLSQPFFVAEVFTGSPGK.Y
-6.37 1 20 3.2 2 FLGIFNTGLKMFPDLTK   + Oxidation (M)
18.1 1 5 90 3 NKVTILHNNGFGNLSSLE   + Deamidated (NQ)
-15.1 1 4 1.1e+002 4 QPQKQAAIALLTMVVNSK   + 2 Deamidated (NQ); Oxidation (M)
-15.1 1 4 1.1e+002 4 QPQKQAAIALLTMVVNSK   + 2 Deamidated (NQ); Oxidation (M)
-15.1 1 4 1.1e+002 4 QPQKQAAIALLTMVVNSK   + 2 Deamidated (NQ); Oxidation (M)
-5.57 1 2 1.9e+002 7 SLDNATLSDLVQKPELSK  
-1.88 1 1 2.5e+002 8 LQNPNPVILTFIQKSLE   + 4 Deamidated (NQ)
8.90 0 0 2.6e+002 9 SLFLSQNVFVFLNVSLE   + 2 Deamidated (NQ)
8.90 0 0 2.6e+002 9 SLFLSQNVFVFLNVSLE   + 2 Deamidated (NQ)
3826 +2 813.0854 2436.2344 2436.1921 17.3 1 81 8.8e-008 +1Score > 38 indicates identity
Score > 23 indicates homology
U X R.GIHQPAPSFADQAGGNDLLETGIK.V + Deamidated (NQ)
4630   961.9965 3843.9569 3843.9055 13.4 1 38 0.018 +1Score > 33 indicates identity U X K.EGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSR.D + Deamidated (NQ)
4630   961.9965 3843.9569 3843.9055 13.4 0 35 0.04 +2Score > 33 indicates identity U X K.NGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSR.D + 2 Deamidated (NQ)

+22 subsets and intersections (602 subset proteins in total)


+3

Accession Score Description
Family member distances as a dendrogram 1 ATPA_PSEPK 882 ATP synthase subunit alpha OS=Pseudomonas putida (strain KT2440) GN=atpA PE=3 SV=1
3 ATPA_RICAH 169 ATP synthase subunit alpha OS=Rickettsia akari (strain Hartford) GN=atpA PE=3 SV=1
2 ATPA_VEREI 206 ATP synthase subunit alpha OS=Verminephrobacter eiseniae (strain EF01-2) GN=atpA PE=3 SV=1

+4

Accession Score Description
Family member distances as a dendrogram 1 CH60_PSEPK 450 60 kDa chaperonin OS=Pseudomonas putida (strain KT2440) GN=groL PE=3 SV=1
3 CH602_SORC5 70 60 kDa chaperonin 2 OS=Sorangium cellulosum (strain So ce56) GN=groL2 PE=3 SV=1
2 CH601_ECOK1 115 60 kDa chaperonin 1 OS=Escherichia coli O1:K1 / APEC GN=groL1 PE=3 SV=1

+5

Accession Score Description
1 RL1_PSEE4 402 50S ribosomal protein L1 OS=Pseudomonas entomophila (strain L48) GN=rplA PE=3 SV=1

+6

Accession Score Description
1 RPOC_PSEPK 364 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida (strain KT2440) GN=rpoC PE=3 SV=1

+7

Accession Score Description
1 DBHB_PSEAE 308 DNA-binding protein HU-beta OS=Pseudomonas aeruginosa GN=hupB PE=1 SV=3

+8

Accession Score Description
Family member distances as a dendrogram 1 PORF_PSESY 290 Outer membrane porin F OS=Pseudomonas syringae pv. syringae GN=oprF PE=3 SV=1
2 PORF_PSEAE 78 Outer membrane porin F OS=Pseudomonas aeruginosa GN=oprF PE=1 SV=1

+9

Accession Score Description
Family member distances as a dendrogram 1 RL4_PSEP1 287 50S ribosomal protein L4 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rplD PE=3 SV=1
2 RL4_PSE14 192 50S ribosomal protein L4 OS=Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6) GN=rplD PE=3 SV=1

+10

Accession Score Description
1 OTCC_PSEPK 280 Ornithine carbamoyltransferase, catabolic OS=Pseudomonas putida (strain KT2440) GN=arcB PE=3 SV=3
Page: 1 2 3 4 5 6  19 Next 

Not what you expected? Try the select summary.