Rita4 sp (Mascot Search Results)

Search metadata
User	:	Jennifer
E-mail	:	[email protected]
Search title	:	Rita4 sp
MS data file	:	PRT1270_T-BRSC_4_20250714120925.mgf
Database	:	SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp	:	12 Aug 2025 at 23:41:34 GMT

Search metadata

User

Jennifer

E-mail

[email protected]

Search title

Rita4 sp

MS data file

PRT1270_T-BRSC_4_20250714120925.mgf

Database

SwissProt 57.15 (515,203 sequences; 181,334,896 residues)

Timestamp

12 Aug 2025 at 23:41:34 GMT

Search parameters
Type of search	:	MS/MS Ion Search
Enzyme	:	GluC_Trypsin
Fixed modifications	:	Carbamidomethyl (C)
Variable modifications	:	Deamidated (NQ), Oxidation (M)
Mass values	:	Monoisotopic
Protein mass	:	Unrestricted
Peptide mass tolerance	:	± 20 ppm
Fragment mass tolerance	:	± 0.1 Da
Max missed cleavages	:	1
Instrument type	:	ESI-FTICR
Number of queries	:	4,786

Search parameters

Type of search

MS/MS Ion Search

Enzyme

GluC_Trypsin

Fixed modifications

Carbamidomethyl (C)

Variable modifications

Deamidated (NQ),

Oxidation (M)

Mass values

Monoisotopic

Protein mass

Unrestricted

Peptide mass tolerance

± 20 ppm

Fragment mass tolerance

± 0.1 Da

Max missed cleavages

Instrument type

ESI-FTICR

Number of queries

4,786

Legend
Dupes	Expect	Rank	U	Peptide
	0.037	2		GAYSLSLR	significant
	9	1		GFFLFVEGGR	top ranking
	6.4e-005	1		GSSIFGLAPGK	significant and top ranking
	1.3e-006	1		SSGTSYPDVLK	peptide is found in all proteins in family member 1
	6.2e-007	1		VCNYVSWIK	peptide is found in some but not all proteins in family member 2
	6.4e-005	1	U	GSSIFGLAPGK	unique
2	5.7e-005	1		LNTLETEEWFFK	peptide has two duplicates
	0.18	1		LNTLETEEWFFK	duplicate peptide

Legend

Dupes

Expect

Rank

Peptide

0.037

GAYSLSLR

significant

GFFLFVEGGR

top ranking

6.4e-005

GSSIFGLAPGK

significant and top ranking

1.3e-006

SSGTSYPDVLK

peptide is found in all proteins in family member 1

6.2e-007

VCNYVSWIK

peptide is found in some but not all proteins in family member 2

6.4e-005

GSSIFGLAPGK

unique

5.7e-005

LNTLETEEWFFK

peptide has two duplicates

0.18

LNTLETEEWFFK

duplicate peptide

Right-facing triangle (

) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (

) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Protein families 1–10 (out of 182)

1 2 3 4 5 6 … 19 Next

1

	Accession	Score	Description
1	EFTU2_PSEPK	1194	Elongation factor Tu-B OS=Pseudomonas putida (strain KT2440) GN=tufB PE=3 SV=1
3	EFTU_CARRP	163	Elongation factor Tu OS=Carsonella ruddii (strain PV) GN=tuf PE=3 SV=1
2	EFTU1_PSEPK	1113	Elongation factor Tu-A OS=Pseudomonas putida (strain KT2440) GN=tufA PE=3 SV=1

2

		Accession	Score	Description
	1	ATPB_PSEPG	941	ATP synthase subunit beta OS=Pseudomonas putida (strain GB-1) GN=atpD PE=3 SV=1
	2	ATPB_PSESM	569	ATP synthase subunit beta OS=Pseudomonas syringae pv. tomato GN=atpD PE=3 SV=1

Cut threshold Threshold (0):

		Score	Mass	Matches	Sequences	emPAI
2.1	ATPB_PSEPG	941	49415	38 (25)	15 (10)	0.80
	ATP synthase subunit beta OS=Pseudomonas putida (strain GB-1) GN=atpD PE=3 SV=1
	2 samesets of ATPB_PSEPG
	ATPB_PSEPK	941	49385	38 (25)	15 (10)	0.80
	ATP synthase subunit beta OS=Pseudomonas putida (strain KT2440) GN=atpD PE=3 SV=1
	ATPB_PSEP1	941	49385	38 (25)	15 (10)	0.80
	ATP synthase subunit beta OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=atpD PE=3 SV=1
2.2	ATPB_PSESM	569	49518	28 (16)	10 (6)	0.44
	ATP synthase subunit beta OS=Pseudomonas syringae pv. tomato GN=atpD PE=3 SV=1
	1 sameset of ATPB_PSESM
	ATPB_PSEU2	569	49518	28 (16)	10 (6)	0.44
	ATP synthase subunit beta OS=Pseudomonas syringae pv. syringae (strain B728a) GN=atpD PE=3 SV=1

42 peptide matches (23 non-duplicate, 19 duplicate)

Query	Dupes	Observed	Mr(expt)	Mr(calc)	ppm	M	Score	Expect	Rank	U	1	2	Peptide
Query	Dupes	Observed	Mr(expt)	Mr(calc)	ppm	M	Score	Expect	Rank	U	1	2	Peptide
337	1	305.1849	608.3552	608.3533	3.12	0	10	0.58	1Score > 31 indicates identity Score > 20 indicates homology				K.YVSLK.D
693	1	395.7018	789.3890	789.3868	2.80	0	24	1.4	2Score > 43 indicates identity Score > 38 indicates homology				K.DSNVLDK.V
1084	3	481.2809	960.5472	960.5393	8.28	0	66	0.00012	1Score > 39 indicates identity	U			K.VGLFGGAGVGK.T
1087	2	481.7764	961.5382	961.5345	3.88	0	32	0.1	1Score > 39 indicates identity Score > 35 indicates homology	U			R.GVQYVLQR.Y
1088		962.5459	961.5386	961.5345	4.27	0	34	0.15	2Score > 39 indicates identity Score > 39 indicates homology	U			R.GVQYVLQR.Y
1430		561.3224	1120.6302	1120.6128	15.5	0	20	0.07	1Score > 38 indicates identity Score > 21 indicates homology	U			K.DTIAGFSGILK.G
1459	1	567.3195	1132.6244	1132.6162	7.30	1	19	0.49	1Score > 39 indicates identity Score > 28 indicates homology	U			R.VALTGLTMAEK.F
1528		581.3289	1160.6432	1160.6264	14.5	0	26	0.022	1Score > 39 indicates identity Score > 22 indicates homology	U			K.VIDLVCPFAK.G
1638	1	602.8383	1203.6620	1203.6499	10.1	0	27	0.045	1Score > 39 indicates identity Score > 26 indicates homology	U			R.DVVPSVYNALK.V
2156		484.2731	1449.7975	1449.7827	10.2	1	81	1.4e-007	1Score > 38 indicates identity Score > 25 indicates homology	U			R.YTLAGTEVSALLGR.M
2157	2	725.9079	1449.8012	1449.7827	12.8	1	99	2.3e-009	1Score > 37 indicates identity Score > 25 indicates homology	U			R.YTLAGTEVSALLGR.M
2470		533.3040	1596.8902	1596.8723	11.2	0	39	0.028	1Score > 37 indicates identity Score > 36 indicates homology	U			R.GLDVVDTGAAISVPVGK.A
2472	2	799.4532	1596.8918	1596.8723	12.2	0	113	1.4e-009	1Score > 37 indicates identity	U			R.GLDVVDTGAAISVPVGK.A
2633		557.0013	1667.9821	1667.9610	12.6	1	60	5.9e-005	1Score > 31 indicates identity	U			R.IVQIIGAVIDVEFPR.D
2634	3	834.9993	1667.9840	1667.9610	13.8	1	101	4.3e-009	1Score > 30 indicates identity	U			R.IVQIIGAVIDVEFPR.D
					D:\Xcalibur\Data\Jennifer\PRT1270 Rita DDA\PRT1270_T-BRSC_4_20250714120925.raw Score > 34 indicates identity Score > 31 indicates homology
2717	1	571.3332	1710.9778	1710.9556	13.0	1	52	0.00046	1Score > 34 indicates identity Score > 31 indicates homology	U			K.YVSLKDTIAGFSGILK.G
					0.60	1	16	2.1	2				QQPITTTLELVDIIK
					15.3	1	7	14	3				VGNGILESDIIVQNLK
					11.0	1	4	32	4				QNTTIVMPIPVELLK + Oxidation (M)
					-9.09	1	4	33	5				HRVLPPQILLNWPK + Deamidated (NQ)
					6.41	1	4	33	5				YAIALTHLQASPKLGK + Deamidated (NQ)
					12.6	0	2	49	7				QAMVLSASLARPSKPR
					13.0	1	2	51	8				TVEILSQHPYIVALK + Deamidated (NQ)
					6.38	1	1	58	9				KPEGVIIQFGGQTPLK
					6.38	1	1	58	9				KPEGVILQFGGQTPLK
2951		619.3053	1854.8941	1854.8860	4.33	1	26	0.46	1Score > 40 indicates identity Score > 35 indicates homology	U			R.QLDPNVIGQEHYDTAR.G
2955		928.9550	1855.8954	1855.8700	13.7	1	43	0.028	1Score > 40 indicates identity	U			R.QLDPNVIGQEHYDTAR.G + Deamidated (NQ)
2956		619.6409	1855.9009	1855.8700	16.6	1	21	0.14	1Score > 40 indicates identity Score > 25 indicates homology	U			R.QLDPNVIGQEHYDTAR.G + Deamidated (NQ)
3096		979.5202	1957.0258	1956.9986	13.9	1	82	1.9e-006	1Score > 38 indicates identity Score > 37 indicates homology	U			R.FLSQPFFVAEVFTGSPGK.Y
3826	2	813.0854	2436.2344	2436.1921	17.3	1	81	8.8e-008	1Score > 38 indicates identity Score > 23 indicates homology	U			R.GIHQPAPSFADQAGGNDLLETGIK.V + Deamidated (NQ)
4630		961.9965	3843.9569	3843.9055	13.4	1	38	0.018	1Score > 33 indicates identity	U			K.EGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSR.D + Deamidated (NQ)
4630		961.9965	3843.9569	3843.9055	13.4	0	35	0.04	2Score > 33 indicates identity	U			K.NGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSR.D + 2 Deamidated (NQ)

22 subsets and intersections (602 subset proteins in total)

3

	Accession	Score	Description
1	ATPA_PSEPK	882	ATP synthase subunit alpha OS=Pseudomonas putida (strain KT2440) GN=atpA PE=3 SV=1
3	ATPA_RICAH	169	ATP synthase subunit alpha OS=Rickettsia akari (strain Hartford) GN=atpA PE=3 SV=1
2	ATPA_VEREI	206	ATP synthase subunit alpha OS=Verminephrobacter eiseniae (strain EF01-2) GN=atpA PE=3 SV=1

4

	Accession	Score	Description
1	CH60_PSEPK	450	60 kDa chaperonin OS=Pseudomonas putida (strain KT2440) GN=groL PE=3 SV=1
3	CH602_SORC5	70	60 kDa chaperonin 2 OS=Sorangium cellulosum (strain So ce56) GN=groL2 PE=3 SV=1
2	CH601_ECOK1	115	60 kDa chaperonin 1 OS=Escherichia coli O1:K1 / APEC GN=groL1 PE=3 SV=1

5

		Accession	Score	Description
	1	RL1_PSEE4	402	50S ribosomal protein L1 OS=Pseudomonas entomophila (strain L48) GN=rplA PE=3 SV=1

6

		Accession	Score	Description
	1	RPOC_PSEPK	364	DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida (strain KT2440) GN=rpoC PE=3 SV=1

7

		Accession	Score	Description
	1	DBHB_PSEAE	308	DNA-binding protein HU-beta OS=Pseudomonas aeruginosa GN=hupB PE=1 SV=3

8

	Accession	Score	Description
1	PORF_PSESY	290	Outer membrane porin F OS=Pseudomonas syringae pv. syringae GN=oprF PE=3 SV=1
2	PORF_PSEAE	78	Outer membrane porin F OS=Pseudomonas aeruginosa GN=oprF PE=1 SV=1

9

	Accession	Score	Description
1	RL4_PSEP1	287	50S ribosomal protein L4 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rplD PE=3 SV=1
2	RL4_PSE14	192	50S ribosomal protein L4 OS=Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6) GN=rplD PE=3 SV=1

10

		Accession	Score	Description
	1	OTCC_PSEPK	280	Ornithine carbamoyltransferase, catabolic OS=Pseudomonas putida (strain KT2440) GN=arcB PE=3 SV=3

1 2 3 4 5 6 … 19 Next

Not what you expected? Try the select summary.

MASCOT Search Results

Score distribution

Protein Family Summary

Protein families 1–10 (out of 182)

1

2

42 peptide matches (23 non-duplicate, 19 duplicate)

D:\Xcalibur\Data\Jennifer\PRT1270 Rita DDA\PRT1270_T-BRSC_4_20250714120925.raw

22 subsets and intersections (602 subset proteins in total)

3

4

5

6

7

8

9

10