MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita3 sp
MS data file : PRT1270_T-BRSC_3_20250714120051.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 23:41:29 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 5,012

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 2701–2800 (out of 3956)

Page: Previous 1 …23 24 25 26 27 28 29 30 31 32 33 … 40 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
1010 961.5333 960.5260 960.5175 8.90 1 2 0.98 +1Score > 41 indicates identity
Score > 15 indicates homology		 KCQSLIGR
4088 910.4780 2728.4122 2728.4258 -4.99 1 2 0.9 +1Score > 36 indicates identity
Score > 14 indicates homology		 TARFMIQDLLGNVYKPLGDLSSYK
4199 938.5092 2812.5058 2812.5262 -7.27 1 2 1 +1Score > 34 indicates identity
Score > 15 indicates homology		 IVQILGPVVDISFAGQKIPAIYNNLE + 2 Deamidated (NQ)
4491 795.4095 3177.6089 3177.6104 -0.46 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 HPMTDLDRQMIDWFAPSGKPIHVLLTK + 2 Oxidation (M)
2631 861.9461 1721.8776 1721.8883 -6.17 1 2 0.81 +1Score > 40 indicates identity
Score > 14 indicates homology		 ALVQVLACRTADSYR
3316 1068.6044 2135.1942 2135.1521 19.7 0 2 0.82 +1Score > 32 indicates identity
Score > 14 indicates homology		 IISGILHVANTGNVQAVLCR + Deamidated (NQ)
4235 948.5034 2842.4884 2842.4739 5.09 1 2 1 +1Score > 35 indicates identity
Score > 15 indicates homology		 TLVLLSALVLLAFQVQADPIQNTDEE + 3 Deamidated (NQ)
4661 901.9545 3603.7889 3603.8316 -11.9 1 2 1 +1Score > 34 indicates identity
Score > 15 indicates homology		 HNVIPILQAGIDNFDLIKYLISQLVMSNMNR + 3 Deamidated (NQ); 2 Oxidation (M)
4016 887.4426 2659.3060 2659.3163 -3.89 1 2 0.98 +1Score > 38 indicates identity
Score > 15 indicates homology		 FTDTPMSRLNSVTTGSIYQAVINK + Deamidated (NQ); Oxidation (M)
839 898.4602 897.4529 897.4556 -2.94 1 2 1 +1Score > 39 indicates identity
Score > 15 indicates homology		 AHNLKSVE + Deamidated (NQ)
2698 876.4698 1750.9250 1750.9213 2.12 1 2 0.99 +1Score > 39 indicates identity
Score > 15 indicates homology		 GPQTVQALAAATGLAPER + Deamidated (NQ)
4060 676.6050 2702.3909 2702.3408 18.6 0 2 0.71 +1Score > 37 indicates identity
Score > 13 indicates homology		 VVTPDLYIACGISGAIQHLAGMSNSK + Deamidated (NQ)
3381 1086.5739 2171.1332 2171.1375 -1.96 1 2 0.94 +1Score > 38 indicates identity
Score > 14 indicates homology		 WVNVYSGEIVPGADIAIVGGR
3831 826.4360 2476.2862 2476.2672 7.66 1 2 0.92 +1Score > 37 indicates identity
Score > 14 indicates homology		 MTQHFLLFDIGNTNVKIGIAVE + Deamidated (NQ); Oxidation (M)
3882 842.4622 2524.3648 2524.3360 11.4 1 2 0.82 +1Score > 34 indicates identity
Score > 14 indicates homology		 VGEVANLMVDAGLVVLTAFISPHR + Deamidated (NQ); Oxidation (M)
4007 885.4638 2653.3696 2653.4075 -14.3 1 2 0.86 +1Score > 37 indicates identity
Score > 14 indicates homology		 SNAPPTPIALSSPGGLDVAGHLAELLR + Deamidated (NQ)
4148 695.8719 2779.4585 2779.4731 -5.26 1 2 0.96 +1Score > 36 indicates identity
Score > 14 indicates homology		 IIIMADADVDGSHIRTLLLTFFFR + Oxidation (M)
4485 792.4274 3165.6805 3165.7397 -18.7 1 2 1 +1Score > 33 indicates identity
Score > 15 indicates homology		 VQAHATIPHISSPTILKTLNGSQGIGVILAE + Deamidated (NQ)
4207 705.3588 2817.4061 2817.4119 -2.06 1 2 1 +1Score > 37 indicates identity
Score > 15 indicates homology		 LSVMVIFNHEASAHAAASSLLAAALGHE + Deamidated (NQ)
4987 1153.6154 5763.0406 5762.9312 19.0 1 2 0.83 +1Score > 27 indicates identity
Score > 14 indicates homology		 MANTVGGILSGVNPFHYNSSSPLTLFLFQACLILLVCNLIHIPFSMMRQPK + Deamidated (NQ); Oxidation (M)
2938 955.5193 1909.0240 1909.0534 -15.4 1 2 0.99 +1Score > 37 indicates identity
Score > 15 indicates homology		 AAGLNPAFARTIGIAVDPR
3658 778.3992 2332.1758 2332.1634 5.32 1 2 0.67 +1Score > 38 indicates identity
Score > 13 indicates homology		 DFINFPNVGKSNLVNRPMPR + 2 Deamidated (NQ); Oxidation (M)
4132 925.5128 2773.5166 2773.4659 18.3 1 2 1 +1Score > 32 indicates identity
Score > 15 indicates homology		 RGNVMGIALGGLAMGVLVGPPFGSVLYE
3488 1117.1460 2232.2774 2232.2625 6.68 1 2 1 +1Score > 30 indicates identity
Score > 15 indicates homology		 IAAMLILQQVLDIMKIYQI + Oxidation (M)
3536 753.7317 2258.1733 2258.2059 -14.4 0 2 0.74 +1Score > 38 indicates identity
Score > 13 indicates homology		 HLTQHAIDAVNLNIINFVPK + 2 Deamidated (NQ)
4365 996.8347 2987.4823 2987.4328 16.6 1 2 0.71 +1Score > 37 indicates identity
Score > 13 indicates homology		 TNMMTHLSKINGDIAQTTLDITHTSSR + 2 Deamidated (NQ)
3518 749.7570 2246.2492 2246.2279 9.47 1 2 0.8 +1Score > 33 indicates identity
Score > 14 indicates homology		 LPYTIGGGIGQSRLCMLLLGK
3542 755.3891 2263.1455 2263.1783 -14.5 1 2 0.75 +1Score > 39 indicates identity
Score > 13 indicates homology		 SLVLLDMVHFAQTQNTFKR + Oxidation (M)
3923 854.1216 2559.3430 2559.3804 -14.6 1 2 0.74 +1Score > 36 indicates identity
Score > 13 indicates homology		 IAMSFALAGLKIGGITILDPDCVGK
4266 959.5063 2875.4971 2875.5054 -2.91 1 2 0.84 +1Score > 35 indicates identity
Score > 14 indicates homology		 QAWLAFSGNSQIFALHLRTLVLMDK + Deamidated (NQ); Oxidation (M)
2970 966.0477 1930.0808 1930.0623 9.62 1 2 0.85 +1Score > 34 indicates identity
Score > 14 indicates homology		 VSTDAQLSGLTVVLTGKLE
717 423.2827 844.5508 844.5382 15.0 1 2 1 +1Score > 27 indicates identity
Score > 14 indicates homology		 KAISIVSK
4562 828.4615 3309.8169 3309.7824 10.4 1 2 1 +1Score > 29 indicates identity
Score > 14 indicates homology		 QVIKLDATTTSVLITCVMAIMIPLALMFGK + 2 Oxidation (M)
2493 830.4866 1658.9586 1658.9396 11.5 0 2 1 +1Score > 32 indicates identity
Score > 14 indicates homology		 TLLLASWGFQLLGAGL
3148 681.0297 2040.0673 2040.0276 19.4 0 2 1 +1Score > 38 indicates identity
Score > 14 indicates homology		 DPIVSQPGAFSNGQTAVVPR + Deamidated (NQ)
1298 1102.5792 1101.5719 1101.5527 17.5 1 2 0.94 +1Score > 42 indicates identity
Score > 14 indicates homology		 QGDAKTQAQR
4679 913.4722 3649.8597 3649.7988 16.7 0 2 1 +1Score > 34 indicates identity
Score > 14 indicates homology		 GPFVSGWAAAISFGTSVGMNAQDLLINYGIQGGAHK + Oxidation (M)
3937 516.2677 2576.3021 2576.3082 -2.38 1 2 0.81 +1Score > 38 indicates identity
Score > 14 indicates homology		 NVDPVGVHTGDSITVAPALTLTDRE
4369 748.4030 2989.5829 2989.6385 -18.6 1 2 0.79 +1Score > 34 indicates identity
Score > 13 indicates homology		 MFQVAGLIVFCGLLAQTTALLEALPLGK + Oxidation (M)
544 383.2314 764.4482 764.4545 -8.14 1 2 1 +1Score > 35 indicates identity
Score > 14 indicates homology		 ITFKTR
4275 722.4031 2885.5833 2885.5287 18.9 0 2 0.74 +1Score > 31 indicates identity
Score > 13 indicates homology		 HFAVVDGKPTAITPAHTNLGLAIDLQGK + 2 Deamidated (NQ)
802 880.4254 879.4181 879.4160 2.36 0 2 0.84 +1Score > 42 indicates identity
Score > 14 indicates homology		 MDPQFVK + Oxidation (M)
3960 650.5992 2598.3677 2598.3556 4.65 0 2 1 +1Score > 36 indicates identity
Score > 14 indicates homology		 FGVWIGGSILASLSTFQQMWIIK + Deamidated (NQ); Oxidation (M)
3207 520.3138 2077.2261 2077.1984 13.3 0 2 0.78 +1Score > 26 indicates identity
Score > 13 indicates homology		 MAVIFCFALLLVLWILR
4446 1035.5618 3103.6636 3103.6702 -2.12 1 2 1 +1Score > 33 indicates identity
Score > 14 indicates homology		 MPLLGGMVVTAIVTYGLLLLEDAGFRPLE + Oxidation (M)
3906 511.2434 2551.1806 2551.1717 3.51 0 2 0.95 +1Score > 37 indicates identity
Score > 14 indicates homology		 QGTMVGGVIAEPNAQMSTAADMATGK + Oxidation (M)
2953 960.5464 1919.0782 1919.0516 13.9 1 2 0.89 +1Score > 33 indicates identity
Score > 14 indicates homology		 VSIPYKPNEYLQVTLR
3216 696.7064 2087.0974 2087.1071 -4.68 0 2 0.72 +1Score > 38 indicates identity
Score > 13 indicates homology		 IALMPQSTSDVLTLLAATLE + Deamidated (NQ)
2648 865.4819 1728.9492 1728.9154 19.6 0 2 0.92 +1Score > 37 indicates identity
Score > 14 indicates homology		 VTMINAIPMASLDPIK + Oxidation (M)
4053 675.1216 2696.4573 2696.4241 12.3 0 2 1 +1Score > 34 indicates identity
Score > 14 indicates homology		 MQPTLLLSLLGAVGLAAVNSMPVDNR + Deamidated (NQ); Oxidation (M)
4109 918.1817 2751.5233 2751.5283 -1.83 1 2 1 +1Score > 31 indicates identity
Score > 14 indicates homology		 ISDVASIVGVRDNHLIGYSLVVGLQK
4280 963.8286 2888.4640 2888.4087 19.1 1 2 1 +1Score > 37 indicates identity
Score > 14 indicates homology		 RLQHSGQFSGLNSQTANTQITQMLVE + Deamidated (NQ)
4714 951.5056 3801.9933 3801.9943 -0.27 0 2 0.74 +1Score > 32 indicates identity
Score > 13 indicates homology		 MITDVQLAIFSNVLGVFLFLLVVAYHYINANTGK + 3 Deamidated (NQ); Oxidation (M)
3987 878.4499 2632.3279 2632.3023 9.71 1 2 0.78 +1Score > 37 indicates identity
Score > 13 indicates homology		 DAIPQVMNGMGVAIVTTPKGVMTDR + 2 Oxidation (M)
4555 662.3653 3306.7901 3306.7839 1.89 1 2 0.74 +1Score > 31 indicates identity
Score > 13 indicates homology		 IIYIVLLVHHTVWNGNGMIGFQVLLRIGE + 3 Deamidated (NQ)
3982 876.7482 2627.2228 2627.2207 0.79 1 2 0.94 +1Score > 37 indicates identity
Score > 14 indicates homology		 MNRTFNNGIGMVVVVDAANAQATAK + 4 Deamidated (NQ); 2 Oxidation (M)
4329 978.8383 2933.4931 2933.4494 14.9 1 2 1 +1Score > 36 indicates identity
Score > 14 indicates homology		 NVIIYTDGACRGNPGPGGWGAILLYGDK
2692 581.9819 1742.9239 1742.9138 5.79 0 2 0.94 +1Score > 39 indicates identity
Score > 14 indicates homology		 VTMVLPLNVSGAFHSR + Oxidation (M)
3336 1075.0225 2148.0304 2148.0222 3.82 1 2 0.95 +1Score > 39 indicates identity
Score > 14 indicates homology		 TGAFEPAEATVNAQDLQGSLK + 2 Deamidated (NQ)
3944 861.4499 2581.3279 2581.2799 18.6 1 2 0.86 +1Score > 37 indicates identity
Score > 14 indicates homology		 QSVVENTISIVSIFVNPTQFNDK + 3 Deamidated (NQ)
3547 756.0656 2265.1750 2265.1576 7.69 1 2 0.93 +1Score > 38 indicates identity
Score > 14 indicates homology		 ALGAAIPQYAHVPMILGADGER + Oxidation (M)
3465 738.0298 2211.0676 2211.0565 5.01 1 2 0.85 +1Score > 39 indicates identity
Score > 14 indicates homology		 PVVSLAQMMESGVHFGHQTR + Deamidated (NQ)
3514 562.0583 2244.2041 2244.2286 -10.9 1 2 1 +1Score > 36 indicates identity
Score > 14 indicates homology		 NLLLTTILADAINLGLTKMAE + Deamidated (NQ); Oxidation (M)
4467 1045.8459 3134.5159 3134.5767 -19.4 1 2 1 +1Score > 36 indicates identity
Score > 14 indicates homology		 VTNIVFMGMGEPLLNIDDLLLSIRSINE + 3 Deamidated (NQ); Oxidation (M)
3395 726.7391 2177.1955 2177.1997 -1.93 1 2 0.69 +1Score > 34 indicates identity
Score > 13 indicates homology		 KQILIEPVFAQWIQAAHGK + Deamidated (NQ)
3638 774.0679 2319.1819 2319.1423 17.1 1 2 0.75 +1Score > 38 indicates identity
Score > 13 indicates homology		 DKAASVAIGNYLFLPHPVYDE + Deamidated (NQ)
4206 564.4862 2817.3946 2817.4001 -1.94 0 2 0.95 +1Score > 37 indicates identity
Score > 14 indicates homology		 IVTGQAGDGITMQGSQLAQMLGLVQGSR + 2 Deamidated (NQ)
4419 768.1071 3068.3993 3068.4179 -6.06 1 2 1 +1Score > 35 indicates identity
Score > 14 indicates homology		 VSTMNHPQIQAPSVMNGTSLSHLSNGESK + 2 Deamidated (NQ); Oxidation (M)
4629 1163.6310 3487.8712 3487.9152 -12.6 1 2 0.92 +1Score > 31 indicates identity
Score > 14 indicates homology		 LLPMANIIIEPAKVLFLNNALNHGIFTPLGVE + Deamidated (NQ); Oxidation (M)
4990 970.1581 5814.9049 5814.9090 -0.70 1 2 1 +1Score > 28 indicates identity
Score > 14 indicates homology		 MTANHLHQGIALQVPPYNYAHPDDLLAAALDQPPALLVALDNLSDPRNLGAIVR + 7 Deamidated (NQ); Oxidation (M)
2400 538.2926 1611.8560 1611.8580 -1.29 1 2 0.97 +1Score > 39 indicates identity
Score > 14 indicates homology		 VSAEAVTTTLHQVTR
3995 879.4556 2635.3450 2635.3646 -7.44 1 2 0.87 +1Score > 37 indicates identity
Score > 14 indicates homology		 LFNIAVQKHGTQFNLIADYVQSK + 2 Deamidated (NQ)
4441 1031.8636 3092.5690 3092.5513 5.71 1 2 0.91 +1Score > 36 indicates identity
Score > 14 indicates homology		 AQVINTNYLSLVTQNNLNKSQGTLGSAIE + 3 Deamidated (NQ)
2903 941.4813 1880.9480 1880.9116 19.4 1 2 0.81 +1Score > 39 indicates identity
Score > 13 indicates homology		 VNQGFLVSEQDTSTISR + Deamidated (NQ)
3043 660.7459 1979.2159 1979.1931 11.5 1 2 0.78 +1Score > 20 indicates identity
Score > 13 indicates homology		 LLKHYLQSGIVVLINIR + Deamidated (NQ)
4515 803.9271 3211.6793 3211.6488 9.48 0 2 1 +1Score > 34 indicates identity
Score > 14 indicates homology		 DLCNGVAGAGHSPWALAGGLLLSLGPALLWAGP + Deamidated (NQ)
4567 1106.8975 3317.6707 3317.6319 11.7 1 2 1 +1Score > 35 indicates identity
Score > 14 indicates homology		 MAIATVVNNLGSTLGACGDINRNVMAPAAPFR + Deamidated (NQ); Oxidation (M)
4676 907.4648 3625.8301 3625.8621 -8.82 1 2 1 +1Score > 34 indicates identity
Score > 14 indicates homology		 MSLNQAASVNNLVLSPNTTLKDVALNALAGQVDAR + 2 Deamidated (NQ); Oxidation (M)
4268 720.1592 2876.6077 2876.5719 12.4 1 2 1 +1Score > 30 indicates identity
Score > 14 indicates homology		 GNITIQIQGNGPLKLLLVNGSDSQQIR + Deamidated (NQ)
2635 575.0228 1722.0466 1722.0152 18.2 1 2 0.7 +1Score > 26 indicates identity
Score > 13 indicates homology		 LSIPIQIGGGIRTIQR + Deamidated (NQ)
4156 927.5009 2779.4809 2779.5219 -14.7 1 2 1 +1Score > 34 indicates identity
Score > 14 indicates homology		 KLNDTAILIGSSTGGPPVVSSIISNIPK + 2 Deamidated (NQ)
4530 1079.8967 3236.6683 3236.6309 11.6 1 2 1 +1Score > 35 indicates identity
Score > 14 indicates homology		 RPLTMAEMLPTNITVDDISINSVITAFDK + 2 Oxidation (M)
2079 736.3634 1470.7122 1470.7249 -8.60 1 2 0.87 +1Score > 41 indicates identity
Score > 14 indicates homology		 EAPINVGMLNGGQR + Oxidation (M)
760 862.4481 861.4408 861.4378 3.49 0 2 1 +1Score > 42 indicates identity
Score > 14 indicates homology		 MLLDAQR + Oxidation (M)
3551 1134.0774 2266.1402 2266.1004 17.6 1 2 0.84 +1Score > 39 indicates identity
Score > 13 indicates homology		 TNQLLQAQGIAPINWQPELE + 4 Deamidated (NQ)
4656 894.4910 3573.9349 3573.8945 11.3 1 2 1 +1Score > 30 indicates identity
Score > 14 indicates homology		 NNNIMNLIAAIVLSLSIIFGWQYFVVKPEHK + 3 Deamidated (NQ)
3804 819.1179 2454.3319 2454.3594 -11.2 1 2 0.78 +1Score > 34 indicates identity
Score > 13 indicates homology		 AVLVAAYIAASRNVPSNNNGLLVK + Deamidated (NQ)
4226 710.1279 2836.4825 2836.4689 4.78 1 2 0.87 +1Score > 35 indicates identity
Score > 14 indicates homology		 SMWIVATMLIVFGMILAVADAVGRQE + Oxidation (M)
4290 724.6469 2894.5585 2894.5283 10.4 1 2 0.95 +1Score > 33 indicates identity
Score > 14 indicates homology		 AAAANLSDLAAMGATPAGITLALALPSDRR + Oxidation (M)
4301 969.4871 2905.4395 2905.4147 8.51 0 2 0.97 +1Score > 37 indicates identity
Score > 14 indicates homology		 YQLQDGWTSVHFVRPAHGLVALHGSE + 2 Deamidated (NQ)
4493 636.7252 3178.5896 3178.5645 7.90 1 2 0.96 +1Score > 36 indicates identity
Score > 14 indicates homology		 YSGAMVSDIHRILVQGGVFLYPGTIQNPE + 2 Deamidated (NQ); Oxidation (M)
4982 917.9310 5501.5423 5501.6178 -13.7 0 2 0.73 +1Score > 28 indicates identity
Score > 13 indicates homology		 VVPLSTMTVHHVQSSPVVMQPSQHSSALMNPAQNLPGGTRPHTASPPAITQE + 5 Deamidated (NQ); 3 Oxidation (M)
2897 626.6667 1876.9783 1876.9604 9.51 1 2 0.73 +1Score > 39 indicates identity
Score > 13 indicates homology		 MYRIIAADLDGTLLSPE
3701 787.7572 2360.2498 2360.2556 -2.45 1 2 0.95 +1Score > 36 indicates identity
Score > 14 indicates homology		 KMANAVLIKPNQIGTITQTMR + Deamidated (NQ); 2 Oxidation (M)
3519 750.0931 2247.2575 2247.2362 9.48 1 2 1 +1Score > 32 indicates identity
Score > 14 indicates homology		 NPSLHLVLVGQSSLLEQLVAK + 3 Deamidated (NQ)
4361 994.5136 2980.5190 2980.4903 9.62 1 2 0.73 +1Score > 36 indicates identity
Score > 13 indicates homology		 ARNYSYAVLVNAANVNLHHGGGVAGALNR + 3 Deamidated (NQ)
4815 1079.5632 4314.2237 4314.2142 2.19 1 2 0.86 +1Score > 31 indicates identity
Score > 13 indicates homology		 YQMLICALTSGVVANFGAPIGGLLFAIEVTATTAVMGNLWK + Deamidated (NQ); Oxidation (M)
3975 873.0856 2616.2350 2616.2490 -5.35 1 2 0.93 +1Score > 38 indicates identity
Score > 14 indicates homology		 SLGQRHYDVQLIGGMVLNDGNIAE + 2 Deamidated (NQ); Oxidation (M)
4174 932.8239 2795.4499 2795.4415 3.00 1 2 1 +1Score > 36 indicates identity
Score > 14 indicates homology		 EFPTLSVQHQLIDSAAMILIQNPTK + 2 Deamidated (NQ)
2308 787.4805 1572.9464 1572.9239 14.3 1 2 1 +1Score > 27 indicates identity
Score > 14 indicates homology		 GRIDPLQIALPLPVA + Deamidated (NQ)
Page: Previous 1 …23 24 25 26 27 28 29 30 31 32 33 … 40 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/