MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita3 sp
MS data file : PRT1270_T-BRSC_3_20250714120051.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 23:41:29 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 5,012

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 2601–2700 (out of 3956)

Page: Previous 1 …22 23 24 25 26 27 28 29 30 31 32 … 40 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2287 783.9687 1565.9228 1565.9001 14.5 1 3 0.98 +1Score > 31 indicates identity
Score > 15 indicates homology		 RAQLGQLGLQIVNR + Deamidated (NQ)
3031 658.0399 1971.0979 1971.1153 -8.82 1 3 0.89 +1Score > 34 indicates identity
Score > 15 indicates homology		 DSSQLYLQINALIPRLK
4525 809.1387 3232.5257 3232.5744 -15.1 1 3 0.96 +1Score > 36 indicates identity
Score > 15 indicates homology		 NAAHAMVMAQQQLLDLGATSLVELTHLDPE + Deamidated (NQ); Oxidation (M)
4237 948.5558 2842.6456 2842.5891 19.9 1 3 1 +1Score > 25 indicates identity
Score > 15 indicates homology		 IIITWSRGSTIIPIMIGHTIAIHNGK + Deamidated (NQ)
4392 1008.8665 3023.5777 3023.6286 -16.9 1 3 0.95 +1Score > 35 indicates identity
Score > 15 indicates homology		 MYKIQLLSCIALTLILVTNSAPASSSTK + Deamidated (NQ)
2660 867.4984 1732.9822 1732.9584 13.8 1 3 1 +1Score > 33 indicates identity
Score > 15 indicates homology		 HQVLTAVALAAAGGVEAR
2843 921.5083 1841.0020 1841.0119 -5.36 1 3 0.7 +1Score > 37 indicates identity
Score > 14 indicates homology		 ATVVASLLGGGGAKNVNGTR
2980 966.5544 1931.0942 1931.0776 8.60 1 3 0.94 +1Score > 32 indicates identity
Score > 15 indicates homology		 KISIMYGILAFIMLFR + Oxidation (M)
3719 595.7896 2379.1293 2379.1012 11.8 1 3 0.62 +1Score > 39 indicates identity
Score > 13 indicates homology		 MADLQNLEAVADHPNGSAIASPR + 3 Deamidated (NQ)
4159 696.3472 2781.3597 2781.3461 4.88 1 3 0.83 +1Score > 38 indicates identity
Score > 14 indicates homology		 LIMTVTTPEMVMPSSMFLPAAVPDR + 3 Oxidation (M)
3397 727.0248 2178.0526 2178.0119 18.7 1 3 1 +1Score > 40 indicates identity
Score > 15 indicates homology		 HMTPIARDNIMALMTTTTE + 2 Oxidation (M)
4026 892.0929 2673.2569 2673.2322 9.22 1 3 0.68 +1Score > 38 indicates identity
Score > 13 indicates homology		 AIGFTVEPMNFGDTLNFWAWRGE + Oxidation (M)
4099 913.1708 2736.4906 2736.4480 15.6 0 3 1 +1Score > 33 indicates identity
Score > 15 indicates homology		 NMLNVLQSLVTHLNQAVSQIQQLK + 2 Deamidated (NQ); Oxidation (M)
4383 755.3862 3017.5157 3017.5718 -18.6 0 3 0.75 +1Score > 36 indicates identity
Score > 14 indicates homology		 VLAAHNVTMQTITAFFMVPLGIASATGVR + 2 Deamidated (NQ)
2611 856.9928 1711.9710 1711.9468 14.1 0 3 1 +1Score > 35 indicates identity
Score > 15 indicates homology		 GNVSIGNNVVIGAGSILK + Deamidated (NQ)
3770 484.6591 2418.2591 2418.2583 0.32 1 3 0.81 +1Score > 37 indicates identity
Score > 14 indicates homology		 NNIEYDFITLHVGLGTFLPVR + Deamidated (NQ)
761 862.4659 861.4586 861.4556 3.53 0 3 0.78 +1Score > 42 indicates identity
Score > 14 indicates homology		 TSANVTIR + Deamidated (NQ)
3133 679.3690 2035.0852 2035.0520 16.3 1 3 0.94 +1Score > 37 indicates identity
Score > 15 indicates homology		 MQIHRLSPQLINQIAAGE + Deamidated (NQ); Oxidation (M)
3688 590.3235 2357.2649 2357.2460 8.00 1 3 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 GLMVGQGINMAHLRGTLTAFVR + Oxidation (M)
3840 829.7635 2486.2687 2486.3026 -13.6 1 3 0.71 +1Score > 38 indicates identity
Score > 14 indicates homology		 SIIVQPDRVVIGNGPAFGCVLMK + Deamidated (NQ); Oxidation (M)
4289 724.3849 2893.5105 2893.5219 -3.94 1 3 0.77 +1Score > 35 indicates identity
Score > 14 indicates homology		 MQNTQLILTTGGDGTILRTAHAILPLE + Deamidated (NQ); Oxidation (M)
3463 737.3583 2209.0531 2209.0833 -13.7 0 2 1 +1Score > 39 indicates identity
Score > 15 indicates homology		 MYVGLLAGMIMLGLGGSSYTK + 3 Oxidation (M)
4330 978.8460 2933.5162 2933.4579 19.9 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 MYDNILNKPLQLKPNITNSARNLLE + 6 Deamidated (NQ); Oxidation (M)
812 886.4585 885.4512 885.4668 -17.6 0 2 1 +1Score > 40 indicates identity
Score > 15 indicates homology		 QLQVANGR + Deamidated (NQ)
4163 697.8647 2787.4297 2787.4079 7.84 1 2 0.98 +1Score > 36 indicates identity
Score > 15 indicates homology		 VALGNITNVAAAANNAKFNSATWAAPVK + 4 Deamidated (NQ)
2972 644.3706 1930.0900 1930.0887 0.64 1 2 1 +1Score > 33 indicates identity
Score > 15 indicates homology		 VLILDFGSQVTQLIARR + 2 Deamidated (NQ)
3291 1065.0624 2128.1102 2128.0834 12.6 0 2 0.61 +1Score > 38 indicates identity
Score > 13 indicates homology		 IGQLADLAVVVGGDGNMLGATR + 2 Deamidated (NQ)
4108 917.8516 2750.5330 2750.5404 -2.70 1 2 1 +1Score > 30 indicates identity
Score > 15 indicates homology		 HILAGKITGPMADTAILNAALALFIAK + Deamidated (NQ); Oxidation (M)
4520 806.9263 3223.6761 3223.6118 19.9 1 2 1 +1Score > 34 indicates identity
Score > 15 indicates homology		 AGQCGGVLMSTGKVLGIHVGGNGHQGFSAALLK + 3 Deamidated (NQ)
3049 662.0348 1983.0826 1983.0749 3.88 1 2 0.99 +1Score > 36 indicates identity
Score > 15 indicates homology		 VSNNQRLALLSDPVTISR + Deamidated (NQ)
3502 748.6884 2243.0434 2243.0746 -13.9 1 2 0.72 +1Score > 39 indicates identity
Score > 14 indicates homology		 LNDAALTFEPESSTALGFGFR + Deamidated (NQ)
3861 628.0818 2508.2981 2508.3145 -6.56 1 2 0.89 +1Score > 37 indicates identity
Score > 14 indicates homology		 QIVGDMPLLIPGIGAQGGDIEATVK + Deamidated (NQ); Oxidation (M)
3473 741.6855 2222.0347 2222.0195 6.84 1 2 0.64 +1Score > 39 indicates identity
Score > 13 indicates homology		 TISVSDLPNNCLNASSLKCE + Deamidated (NQ)
4894 1149.0664 4592.2365 4592.2607 -5.27 1 2 1 +1Score > 32 indicates identity
Score > 15 indicates homology		 VNWFGTTAWQLTYMQISMAVTLLSNIVTGAILWKSQNQSR + 4 Deamidated (NQ); 2 Oxidation (M)
4286 965.4907 2893.4503 2893.4240 9.08 1 2 1 +1Score > 37 indicates identity
Score > 15 indicates homology		 VNDLLGPGVAQAVDGGSVRVSAPMDPSQR + 2 Deamidated (NQ)
4345 988.7849 2963.3329 2963.2938 13.2 0 2 1 +1Score > 35 indicates identity
Score > 15 indicates homology		 NGGALCSTANTTVQGNSGTVTFSSNTATDK + 3 Deamidated (NQ)
4429 1028.1918 3081.5536 3081.5474 1.99 1 2 0.73 +1Score > 36 indicates identity
Score > 14 indicates homology		 QLDVPITINLNGCPNSCARIQVADIGLK + 3 Deamidated (NQ)
2414 807.9772 1613.9398 1613.9327 4.43 1 2 0.68 +1Score > 32 indicates identity
Score > 13 indicates homology		 QAKIAFLMLPGLGVR + Deamidated (NQ)
3098 672.0016 2012.9830 2012.9846 -0.79 1 2 0.98 +1Score > 40 indicates identity
Score > 15 indicates homology		 QMLIITGPNMGGKSTYMR + Oxidation (M)
4572 1111.9341 3332.7805 3332.7460 10.3 1 2 0.82 +1Score > 32 indicates identity
Score > 14 indicates homology		 SHDLIFNQLYVVFKMIFWFNPALYISK
3945 861.7844 2582.3314 2582.3050 10.2 1 2 0.85 +1Score > 37 indicates identity
Score > 14 indicates homology		 RTLTPALSPCGVSSTLPNWSIPVE + Deamidated (NQ)
4900 770.7249 4618.3057 4618.2896 3.49 1 2 1 +1Score > 31 indicates identity
Score > 15 indicates homology		 GYLEPLQLAEVDTLVLGCTHYPMLSGLIQLAMGDNVTLVSSAE + Deamidated (NQ)
3074 999.9960 1997.9774 1997.9953 -8.92 1 2 0.97 +1Score > 40 indicates identity
Score > 15 indicates homology		 MTTAAQVSGLDVAPTRHAR + Deamidated (NQ); Oxidation (M)
3279 708.0388 2121.0946 2121.0996 -2.37 1 2 0.97 +1Score > 38 indicates identity
Score > 15 indicates homology		 VISMVGRVQMDMLQVLLR + 2 Deamidated (NQ); 2 Oxidation (M)
1156 1021.5747 1020.5674 1020.5716 -4.09 1 2 0.9 +1Score > 39 indicates identity
Score > 14 indicates homology		 GAYIKSLNR
4157 927.7642 2780.2708 2780.2932 -8.06 0 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 LTNPSFGDLNHLISATMSGVTCCLR + Deamidated (NQ); Oxidation (M)
3516 749.3778 2245.1116 2245.1015 4.47 1 2 0.6 +1Score > 39 indicates identity
Score > 13 indicates homology		 FVDNVDIYVSSGKGGAGAVSFR + Deamidated (NQ)
3676 1175.0598 2348.1050 2348.1116 -2.77 1 2 0.93 +1Score > 38 indicates identity
Score > 15 indicates homology		 GEMFGPGNAQLPLPPMLMFNR + 2 Oxidation (M)
4061 676.6340 2702.5069 2702.4690 14.0 1 2 0.81 +1Score > 30 indicates identity
Score > 14 indicates homology		 GVIVRPVANYGMPNHLRITIGLPAE + Oxidation (M)
4278 722.9193 2887.6481 2887.6108 12.9 1 2 0.67 +1Score > 27 indicates identity
Score > 13 indicates homology		 TFVMGLILVIAVIAATLFPLWPAEMR + Oxidation (M)
3139 680.3450 2038.0132 2038.0485 -17.3 1 2 0.93 +1Score > 40 indicates identity
Score > 15 indicates homology		 VNLFTLLSLWMELFPAE + Oxidation (M)
3990 659.1157 2632.4337 2632.3820 19.6 1 2 1 +1Score > 33 indicates identity
Score > 15 indicates homology		 GDNIVAADLGVLIQNSAKHVQGNVAK + 2 Deamidated (NQ)
3619 770.7277 2309.1613 2309.1988 -16.3 1 2 0.84 +1Score > 39 indicates identity
Score > 14 indicates homology		 GFRINTNIGALNAHANSVVNAR + Deamidated (NQ)
2300 786.4171 1570.8196 1570.8501 -19.4 1 2 1 +1Score > 40 indicates identity
Score > 15 indicates homology		 ALKNDVVVVAMSPGR + Oxidation (M)
4149 927.4936 2779.4590 2779.4504 3.08 0 2 0.65 +1Score > 35 indicates identity
Score > 13 indicates homology		 ALPPGQGLGPAEPPGLPQLQSLNLSGNR + 2 Deamidated (NQ)
4483 790.6757 3158.6737 3158.6611 3.97 0 2 1 +1Score > 34 indicates identity
Score > 15 indicates homology		 NLGVLAAQFAQPNSVLYDLGASLGAVTQALR + 2 Deamidated (NQ)
3702 787.7572 2360.2498 2360.2052 18.9 0 2 0.82 +1Score > 36 indicates identity
Score > 14 indicates homology		 LQHYYQFQAVLKPAPSDILE + Deamidated (NQ)
3124 1016.5181 2031.0216 2031.0120 4.74 1 2 0.85 +1Score > 39 indicates identity
Score > 14 indicates homology		 SPLKSQQQLPSSSTTQVSE
4045 898.4250 2692.2532 2692.2405 4.70 1 2 1 +1Score > 37 indicates identity
Score > 15 indicates homology		 SPGQHDGTYFGRLGIANPATDFQLE + 2 Deamidated (NQ)
3102 673.6942 2018.0608 2018.0983 -18.6 1 2 0.86 +1Score > 38 indicates identity
Score > 14 indicates homology		 ILGAHMLEVDPTLAASKPR
3119 677.3663 2029.0771 2029.0878 -5.28 0 2 0.88 +1Score > 38 indicates identity
Score > 14 indicates homology		 VTICSVAVINPSSQIVSVR + Deamidated (NQ)
4072 903.8192 2708.4358 2708.4108 9.21 1 2 0.85 +1Score > 35 indicates identity
Score > 14 indicates homology		 WIGSVNSIGMAAGAFLFGLLADRIGR + Deamidated (NQ); Oxidation (M)
4713 948.0104 3788.0125 3787.9771 9.34 1 2 1 +1Score > 31 indicates identity
Score > 15 indicates homology		 TVINLQGDFPTIRPEQIGAVLGPLADPAVDIATLAAE + 3 Deamidated (NQ)
3711 790.3957 2368.1653 2368.1225 18.0 0 2 0.74 +1Score > 39 indicates identity
Score > 14 indicates homology		 SNICVNVVAPGYTATPMVTAMR + Deamidated (NQ); Oxidation (M)
4113 689.6167 2754.4377 2754.4123 9.23 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 LSGARDPIMLYISGGNTQVIAHLNGR + 2 Deamidated (NQ)
4416 1021.8502 3062.5288 3062.5495 -6.76 0 2 0.84 +1Score > 37 indicates identity
Score > 14 indicates homology		 LNANILYLCSSQHVNLDQLQPLHTLR + 3 Deamidated (NQ)
2407 538.6413 1612.9021 1612.8865 9.68 1 2 0.95 +1Score > 37 indicates identity
Score > 15 indicates homology		 EVFIYTPLLSYLR
3555 756.3908 2266.1506 2266.1805 -13.2 1 2 0.83 +1Score > 38 indicates identity
Score > 14 indicates homology		 AASGGTIGLVEDGDIINIDIPAR
3780 809.7172 2426.1298 2426.1644 -14.3 1 2 0.81 +1Score > 38 indicates identity
Score > 14 indicates homology		 ITVQAAVSEVCFAMCNLIDSAK
3966 870.1506 2607.4300 2607.3917 14.7 1 2 1 +1Score > 32 indicates identity
Score > 15 indicates homology		 MVLHSKVAIVGAGAVGASTAYALMFK + Oxidation (M)
4193 937.1877 2808.5413 2808.5686 -9.73 1 2 1 +1Score > 32 indicates identity
Score > 15 indicates homology		 LKMITYLGGILGGFIGIIQGVLAMWI + 2 Oxidation (M)
4593 844.4346 3373.7093 3373.7045 1.42 1 2 1 +1Score > 35 indicates identity
Score > 15 indicates homology		 RMSIFALGIMPYISASIIMQLMTAISPQLE + Deamidated (NQ); 3 Oxidation (M)
1481 591.3668 1180.7190 1180.7067 10.5 1 2 0.97 +1Score > 32 indicates identity
Score > 15 indicates homology		 EIIQVLQLPK + Deamidated (NQ)
2424 809.9974 1617.9802 1617.9566 14.6 1 2 1 +1Score > 25 indicates identity
Score > 15 indicates homology		 KLAPVLQPGAQLDLR
3022 656.6763 1967.0071 1966.9748 16.4 1 2 0.73 +1Score > 39 indicates identity
Score > 13 indicates homology		 QLNAQQTQLRIDSFFR + 3 Deamidated (NQ)
4806 1052.0378 4204.1221 4204.0715 12.0 1 2 1 +1Score > 32 indicates identity
Score > 15 indicates homology		 FTGQFPTAVVGMSGLTFIDIRFNSFSGSIPPQILGQNLE + 3 Deamidated (NQ); Oxidation (M)
4856 887.4502 4432.2146 4432.2373 -5.11 1 2 1 +1Score > 31 indicates identity
Score > 15 indicates homology		 SMFLSTAATAPPSSSKPGPPPQSKPNSSFRPPQKDNPPSLVAK + 2 Deamidated (NQ)
2618 859.9702 1717.9258 1717.9363 -6.07 0 2 0.68 +1Score > 38 indicates identity
Score > 13 indicates homology		 DIPHQLSEPLTITVR
3114 677.0071 2027.9995 2028.0020 -1.22 1 2 1 +1Score > 40 indicates identity
Score > 15 indicates homology		 LGIDMINIHASAGKIAMQE + Deamidated (NQ); Oxidation (M)
4789 826.4310 4127.1186 4127.0610 14.0 1 2 1 +1Score > 32 indicates identity
Score > 15 indicates homology		 SVVGLNFDFVMLNLTKHSSYMIYNVCLYFSPVIQK + Deamidated (NQ)
4073 678.3301 2709.2913 2709.2890 0.83 1 2 0.64 +1Score > 38 indicates identity
Score > 13 indicates homology		 ICASCGQVISGQYVRALGNIYHLE + 2 Deamidated (NQ)
4366 747.8797 2987.4897 2987.5062 -5.54 1 2 0.86 +1Score > 37 indicates identity
Score > 14 indicates homology		 LKDSVFGVPVNVAVMHQAVVNYLANQR + 4 Deamidated (NQ); Oxidation (M)
4379 1005.5052 3013.4938 3013.5008 -2.33 1 2 0.99 +1Score > 37 indicates identity
Score > 15 indicates homology		 LNDLHDLTQCVSLFLFGDVHKDLWK + Deamidated (NQ)
692 837.4134 836.4061 836.3997 7.73 1 2 0.95 +1Score > 42 indicates identity
Score > 15 indicates homology		 KNMCIR + Oxidation (M)
2541 837.4700 1672.9254 1672.9260 -0.35 0 2 0.66 +1Score > 37 indicates identity
Score > 13 indicates homology		 ALQAVFTQASQGALLR
2743 592.3006 1773.8800 1773.8931 -7.40 1 2 0.83 +1Score > 40 indicates identity
Score > 14 indicates homology		 GQGLATAVMDAVEQVLR + Deamidated (NQ); Oxidation (M)
3408 546.2840 2181.1069 2181.0848 10.1 1 2 0.96 +1Score > 39 indicates identity
Score > 15 indicates homology		 ASLQRAVDALLANGMGSSTFR + Deamidated (NQ); Oxidation (M)
3541 754.3991 2260.1755 2260.1344 18.2 1 2 0.96 +1Score > 38 indicates identity
Score > 15 indicates homology		 LAAGWLIDQCDLKGMQIGGAK + Oxidation (M)
3579 761.4057 2281.1953 2281.1776 7.73 1 2 0.71 +1Score > 37 indicates identity
Score > 13 indicates homology		 LGPHVAALMLTNPNTLGLFER + 2 Deamidated (NQ); Oxidation (M)
4673 907.4563 3625.7961 3625.8621 -18.2 1 2 1 +1Score > 35 indicates identity
Score > 15 indicates homology		 MSLNQAASVNNLVLSPNTTLKDVALNALAGQVDAR + 2 Deamidated (NQ); Oxidation (M)
4921 960.4821 4797.3741 4797.3328 8.60 0 2 0.65 +1Score > 31 indicates identity
Score > 13 indicates homology		 SFLAFYVVLAFMCAGFGSILGVDDLLVSFAAGATFAWDGWFSQK + Oxidation (M)
3338 717.0211 2148.0415 2148.0554 -6.51 1 2 0.78 +1Score > 39 indicates identity
Score > 14 indicates homology		 AMALQNVDILNTMQRDLGK + 2 Deamidated (NQ); Oxidation (M)
3998 881.7757 2642.3053 2642.2693 13.6 1 2 1 +1Score > 38 indicates identity
Score > 15 indicates homology		 SDIDQLHHIMTCLGNLIPRHQE + Oxidation (M)
4303 969.8506 2906.5300 2906.5020 9.61 1 2 0.79 +1Score > 34 indicates identity
Score > 14 indicates homology		 QAGLLPMLMQQLPAQLPAVQSVAELIE + 3 Deamidated (NQ); Oxidation (M)
4331 981.8110 2942.4112 2942.4344 -7.91 1 2 0.9 +1Score > 37 indicates identity
Score > 14 indicates homology		 NIVALNAGAALYACGNASHIAEGVHYASK + Deamidated (NQ)
418 704.3718 703.3645 703.3765 -17.1 1 2 0.63 +1Score > 43 indicates identity
Score > 13 indicates homology		 KAWGSR
4341 986.5400 2956.5982 2956.5672 10.5 1 2 0.77 +1Score > 32 indicates identity
Score > 14 indicates homology		 LINILGSDHHGYIGRLHAAVGAFSPDVK
4436 1030.5183 3088.5331 3088.5234 3.13 1 2 0.73 +1Score > 36 indicates identity
Score > 13 indicates homology		 TLNANTSQVCNSVIQGNGLSVQQLEALVK + 4 Deamidated (NQ)
4047 898.4440 2692.3102 2692.2756 12.9 0 2 0.75 +1Score > 38 indicates identity
Score > 13 indicates homology		 LLNEPQFDEPSINSGGQAVVTTFVE + 2 Deamidated (NQ)
4160 928.4884 2782.4434 2782.4330 3.73 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 AQSLFNYFKQLFAQVTNPPIDAIR + 2 Deamidated (NQ)
Page: Previous 1 …22 23 24 25 26 27 28 29 30 31 32 … 40 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/