MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita3 sp
MS data file : PRT1270_T-BRSC_3_20250714120051.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 23:41:29 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 5,012

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 2001–2100 (out of 3956)

Page: Previous 1 …16 17 18 19 20 21 22 23 24 25 26 … 40 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3033 987.0483 1972.0820 1972.1132 -15.8 1 6 0.57 +1Score > 35 indicates identity
Score > 16 indicates homology		 IILVILDAISNIFQAAEK + 2 Deamidated (NQ)
3892 633.8301 2531.2913 2531.3020 -4.21 1 6 0.94 +1Score > 38 indicates identity
Score > 19 indicates homology		 HALQFNSDNVRIVTLYADALIR + 3 Deamidated (NQ)
2108 494.9465 1481.8177 1481.8024 10.3 1 6 0.79 +1Score > 37 indicates identity
Score > 18 indicates homology		 KGGIGLPGLPGANGMK + Oxidation (M)
2340 527.9551 1580.8435 1580.8311 7.84 1 6 0.49 +1Score > 39 indicates identity
Score > 16 indicates homology		 TEVWVLPNPSGLNR
2472 548.9678 1643.8816 1643.8817 -0.096 1 6 0.83 +1Score > 39 indicates identity
Score > 18 indicates homology		 WKDKPVAMSIVQAR + Oxidation (M)
4626 870.7305 3478.8929 3478.8682 7.11 1 6 1 +1Score > 30 indicates identity
Score > 19 indicates homology		 KITNVLCLAILPLSIMTSFFISMAFLYISR + Deamidated (NQ); Oxidation (M)
2736 590.9897 1769.9473 1769.9173 16.9 1 6 0.55 +1Score > 38 indicates identity
Score > 16 indicates homology		 LPDRGGTVPPPSHTPSR
3763 806.4407 2416.3003 2416.2995 0.30 1 6 0.34 +1Score > 35 indicates identity
Score > 14 indicates homology		 QTLITNLQALDCATSLGTKLQK
4697 928.2311 3708.8953 3708.8601 9.50 1 6 1 +1Score > 33 indicates identity
Score > 19 indicates homology		 NALSMMPEAMTIVMLFLLAGLLTSGAVIFFMSPK + Deamidated (NQ); 4 Oxidation (M)
4326 977.1508 2928.4306 2928.3998 10.5 1 6 0.45 +1Score > 37 indicates identity
Score > 15 indicates homology		 SLQQMFSCGRLGGTGYLSILPVDQGVE + Deamidated (NQ); Oxidation (M)
2691 581.9806 1742.9200 1742.8873 18.8 0 6 0.44 +1Score > 39 indicates identity
Score > 15 indicates homology		 AHATVLDINSSMLSVGK + Deamidated (NQ)
3405 728.0410 2181.1012 2181.1277 -12.2 1 6 0.61 +1Score > 39 indicates identity
Score > 16 indicates homology		 LTNLGLVTVSLASGLGQHRDE + 2 Deamidated (NQ)
2604 570.6218 1708.8436 1708.8488 -3.05 1 6 0.47 +1Score > 40 indicates identity
Score > 15 indicates homology		 VAGTNKGITALQMDMK + 2 Oxidation (M)
3271 707.3906 2119.1500 2119.1823 -15.3 1 6 0.64 +1Score > 36 indicates identity
Score > 17 indicates homology		 MLRSLPVHNVIITTGGGIIE
4068 903.4918 2707.4536 2707.4268 9.88 1 6 0.48 +1Score > 34 indicates identity
Score > 15 indicates homology		 WIGSVNSIGMAAGAFLFGLLADRIGR + Oxidation (M)
1882 457.9159 1370.7259 1370.7419 -11.7 1 6 0.97 +1Score > 40 indicates identity
Score > 18 indicates homology		 QQQRWVGQTLK
3500 748.4178 2242.2316 2242.2460 -6.45 0 6 1 +1Score > 34 indicates identity
Score > 19 indicates homology		 LLVVNGPISVAIDVSDLINYK + Deamidated (NQ)
2304 787.4045 1572.7944 1572.8107 -10.4 0 6 0.89 +1Score > 40 indicates identity
Score > 18 indicates homology		 ANTVVANTTINNNVK + Deamidated (NQ)
4343 740.8931 2959.5433 2959.4926 17.1 1 6 0.69 +1Score > 35 indicates identity
Score > 17 indicates homology		 VGKLANAYLYSVDDLQNIIQHNLAQR + 4 Deamidated (NQ)
147 489.2803 488.2730 488.2707 4.78 0 6 0.91 +1Score > 44 indicates identity
Score > 18 indicates homology		 SGGIR
3370 542.2817 2165.0977 2165.1038 -2.81 0 6 0.98 +1Score > 39 indicates identity
Score > 19 indicates homology		 LMIVDDTYILIGSANINQR + Deamidated (NQ); Oxidation (M)
3403 546.2818 2181.0981 2181.0810 7.86 1 6 0.81 +1Score > 39 indicates identity
Score > 18 indicates homology		 KGNIVDGDQIMFIIGQAMSK + Deamidated (NQ); Oxidation (M)
2016 719.9218 1437.8290 1437.8344 -3.70 0 6 0.95 +1Score > 35 indicates identity
Score > 18 indicates homology		 SPLPIVIYNIPGR
3323 714.3848 2140.1326 2140.1000 15.2 1 6 0.72 +1Score > 37 indicates identity
Score > 17 indicates homology		 VIIDAGVQNFMHWLGQRR + Deamidated (NQ)
2996 648.3537 1942.0393 1942.0346 2.40 0 6 0.85 +1Score > 37 indicates identity
Score > 18 indicates homology		 SLLHQGAIDVFTQAIAMK
4918 798.4091 4784.4109 4784.3441 14.0 0 6 0.3 +1Score > 30 indicates identity
Score > 13 indicates homology		 MQIYGLHVHVGMPDGDTAIQVINQITQYAPMLLALSANSPFWE + Oxidation (M)
1503 399.5597 1195.6573 1195.6349 18.7 1 6 0.84 +1Score > 38 indicates identity
Score > 18 indicates homology		 GYGRALVDFAK
2256 388.4656 1549.8333 1549.8253 5.18 1 6 0.74 +1Score > 38 indicates identity
Score > 17 indicates homology		 RFAFLDADIDIVR
2977 966.5519 1931.0892 1931.0887 0.30 1 6 0.48 +1Score > 33 indicates identity
Score > 15 indicates homology		 MINIVNNKVNIIHRPR + Deamidated (NQ)
920 926.5060 925.4987 925.5021 -3.69 0 6 0.91 +1Score > 38 indicates identity
Score > 18 indicates homology		 QIFSYLR
2021 481.2772 1440.8098 1440.7837 18.1 1 6 0.94 +1Score > 37 indicates identity
Score > 18 indicates homology		 IGRAQWVQALAAR + 2 Deamidated (NQ)
4141 927.1060 2778.2962 2778.3494 -19.2 1 6 0.47 +1Score > 37 indicates identity
Score > 15 indicates homology		 SGGIVTQEAPIHVSNVMVIDADGNPTR + 2 Deamidated (NQ)
2987 969.0455 1936.0764 1936.1074 -16.0 0 6 1 +1Score > 35 indicates identity
Score > 18 indicates homology		 QFLASLVSFLLVVWSVK + Deamidated (NQ)
3646 775.4232 2323.2478 2323.2212 11.4 0 6 0.5 +1Score > 35 indicates identity
Score > 15 indicates homology		 IIIFPATGNPNQQWVTQVLPS + Deamidated (NQ)
3111 675.0211 2022.0415 2022.0210 10.1 0 6 0.35 +1Score > 39 indicates identity
Score > 14 indicates homology		 NFHIFYQLLSGANQQLK + 2 Deamidated (NQ)
3277 1061.0891 2120.1636 2120.1728 -4.33 1 6 0.42 +1Score > 34 indicates identity
Score > 15 indicates homology		 NLANLLHIDTNIKITLLAE + 2 Deamidated (NQ)
3343 1076.5577 2151.1008 2151.0848 7.48 1 6 0.83 +1Score > 39 indicates identity
Score > 18 indicates homology		 KPHTTTVAPPQINFIKNNE + 3 Deamidated (NQ)
2178 758.4587 1514.9028 1514.8820 13.7 1 6 0.64 +1Score > 30 indicates identity
Score > 17 indicates homology		 LNVITLHLPPLRE + Deamidated (NQ)
3380 1086.5601 2171.1056 2171.0793 12.1 1 6 0.86 +1Score > 39 indicates identity
Score > 18 indicates homology		 DAAQGGRPLPPMPQELPQPR + Deamidated (NQ); Oxidation (M)
3565 759.3496 2275.0270 2275.0249 0.90 0 6 0.41 +1Score > 37 indicates identity
Score > 15 indicates homology		 WQGCDQMALVAQLSPGQLQE + Deamidated (NQ); Oxidation (M)
1972 472.9416 1415.8030 1415.7885 10.2 1 6 0.81 +1Score > 36 indicates identity
Score > 17 indicates homology		 RNITVFQPATLR + Deamidated (NQ)
3090 1005.5613 2009.1080 2009.1381 -15.0 1 6 0.67 +1Score > 35 indicates identity
Score > 17 indicates homology		 TSLGTINHSLLSLAALRSR
3267 1059.5579 2117.1012 2117.0939 3.46 1 6 0.51 +1Score > 38 indicates identity
Score > 15 indicates homology		 SPSELPGGLQVIHVPDVSMR
334 335.7115 669.4084 669.4061 3.49 0 6 0.98 +1Score > 34 indicates identity
Score > 18 indicates homology		 NPIVVK + Deamidated (NQ)
2095 369.7335 1474.9049 1474.8984 4.42 0 6 1 +1Score > 26 indicates identity
Score > 18 indicates homology		 ITIHTARPGIVIGK
1461 391.2047 1170.5923 1170.6067 -12.3 0 6 0.97 +1Score > 40 indicates identity
Score > 18 indicates homology		 QPSAGPLMNIK + Oxidation (M)
3899 851.1179 2550.3319 2550.2813 19.8 1 6 0.55 +1Score > 36 indicates identity
Score > 16 indicates homology		 INGDINALTDNNKHAIQLIIDNK + 4 Deamidated (NQ)
4029 892.4739 2674.3999 2674.4053 -2.04 1 6 0.72 +1Score > 36 indicates identity
Score > 17 indicates homology		 VAILNANYVMEQLRPHYPVLYR + Oxidation (M)
4183 935.4660 2803.3762 2803.3938 -6.30 1 6 1 +1Score > 38 indicates identity
Score > 18 indicates homology		 LVAPFGDMTVKCHQHYYITTLPGR
2802 604.3375 1809.9907 1810.0061 -8.51 1 6 0.85 +1Score > 36 indicates identity
Score > 18 indicates homology		 IRAIVIQLGDTNLNDR
4531 1080.5189 3238.5349 3238.5641 -9.01 1 6 1 +1Score > 36 indicates identity
Score > 18 indicates homology		 VLLATMNMQTIAQMSCNPAMGGVAKGQIVR + Deamidated (NQ); 3 Oxidation (M)
2049 728.9346 1455.8546 1455.8409 9.41 1 6 0.68 +1Score > 34 indicates identity
Score > 17 indicates homology		 VSVTVLGVKGNQVR + Deamidated (NQ)
2395 538.2697 1611.7873 1611.7562 19.3 0 6 0.79 +1Score > 40 indicates identity
Score > 17 indicates homology		 MANLTYDNVTLSNR + Deamidated (NQ)
2768 599.9969 1796.9689 1796.9421 14.9 1 6 0.58 +1Score > 38 indicates identity
Score > 16 indicates homology		 QANIPNIFAAPSLEGGAK
3430 549.3145 2193.2289 2193.2481 -8.75 1 6 0.52 +1Score > 33 indicates identity
Score > 16 indicates homology		 RSLQADLALALLLDVQQGLR + Deamidated (NQ)
447 723.3593 722.3520 722.3633 -15.6 0 6 0.85 +1Score > 41 indicates identity
Score > 18 indicates homology		 TIMQSK + Oxidation (M)
867 453.7523 905.4900 905.4818 9.10 1 6 0.94 +1Score > 40 indicates identity
Score > 18 indicates homology		 KTVNTTDK
3228 524.8169 2095.2385 2095.2001 18.3 1 6 0.56 +1Score > 26 indicates identity
Score > 16 indicates homology		 SAVNDLTLIAGQKPVLTRAK + Deamidated (NQ)
2202 509.6385 1525.8937 1525.8716 14.5 1 6 0.59 +1Score > 33 indicates identity
Score > 16 indicates homology		 VVLSQVSLAISPGEK
2713 880.0018 1757.9890 1757.9563 18.6 1 6 0.37 +1Score > 35 indicates identity
Score > 14 indicates homology		 LNAQKVINSYPVVALE + Deamidated (NQ)
4192 703.1407 2808.5337 2808.5421 -2.98 0 6 0.53 +1Score > 32 indicates identity
Score > 16 indicates homology		 SLGQFLLQILGMLSGVGIMLLIALYE + Deamidated (NQ); Oxidation (M)
4194 937.4850 2809.4332 2809.3931 14.3 1 6 0.52 +1Score > 36 indicates identity
Score > 15 indicates homology		 SLVFRPPNPWTMAIMNVLAELHQE + Deamidated (NQ); Oxidation (M)
4313 972.8718 2915.5936 2915.5929 0.23 1 6 0.46 +1Score > 32 indicates identity
Score > 15 indicates homology		 MSKNYLLAVLALLLSGPVVAADAIAGTVE + Deamidated (NQ); Oxidation (M)
1056 990.5244 989.5171 989.5216 -4.48 1 6 0.8 +1Score > 41 indicates identity
Score > 17 indicates homology		 VIIDEVMR + Oxidation (M)
2752 595.3116 1782.9130 1782.8822 17.3 0 6 0.49 +1Score > 39 indicates identity
Score > 15 indicates homology		 VADALTTAVAHMDDLPK + Oxidation (M)
3249 704.3753 2110.1041 2110.1423 -18.1 1 6 0.39 +1Score > 38 indicates identity
Score > 14 indicates homology		 LVVSLGTTDVLKQHFNPNK + Deamidated (NQ)
3933 857.4595 2569.3567 2569.3938 -14.4 1 6 0.72 +1Score > 36 indicates identity
Score > 17 indicates homology		 IADILQIPAFLCRQTDLLQAAAK + Deamidated (NQ)
2686 581.9789 1742.9149 1742.9203 -3.10 1 6 0.6 +1Score > 39 indicates identity
Score > 16 indicates homology		 ELQLLLNNVDFNPSK
3607 768.0710 2301.1912 2301.2019 -4.65 1 6 0.7 +1Score > 38 indicates identity
Score > 17 indicates homology		 RVWPDGVIPFVIGGNFTGSQR
4123 923.7947 2768.3623 2768.3839 -7.80 1 6 0.65 +1Score > 38 indicates identity
Score > 16 indicates homology		 MPSLFISGLSDQLIPPVMMKQLYE + 2 Oxidation (M)
3024 493.2650 1969.0309 1969.0342 -1.70 1 6 0.59 +1Score > 38 indicates identity
Score > 16 indicates homology		 AGAIEILMPTIQAADLWR + Deamidated (NQ)
3604 1151.5991 2301.1836 2301.1470 15.9 0 6 0.53 +1Score > 38 indicates identity
Score > 16 indicates homology		 QSVLNLMTRPSVHQGQGMYR
2831 913.5039 1824.9932 1824.9655 15.2 1 6 0.78 +1Score > 37 indicates identity
Score > 17 indicates homology		 DAMEAIDIKPLIEPVR + Oxidation (M)
2514 834.4460 1666.8774 1666.8890 -6.93 1 6 0.93 +1Score > 39 indicates identity
Score > 18 indicates homology		 QQEQVLTVALGQPVR + 2 Deamidated (NQ)
2045 728.4295 1454.8444 1454.8609 -11.3 1 6 0.85 +1Score > 35 indicates identity
Score > 18 indicates homology		 KQYPLGLVLAPTR
3085 1004.0892 2006.1638 2006.1524 5.69 0 6 0.57 +1Score > 29 indicates identity
Score > 16 indicates homology		 VILGLSGGVDSSVTALLLHR
2871 620.6552 1858.9438 1858.9326 6.03 1 6 0.75 +1Score > 40 indicates identity
Score > 17 indicates homology		 YRYNHLDLGDIGGIPR + Deamidated (NQ)
4296 967.8423 2900.5051 2900.4919 4.53 1 6 1 +1Score > 36 indicates identity
Score > 18 indicates homology		 AGADYLVLGRPIYAADDPKAAAQAIIQE + Deamidated (NQ)
2170 379.2156 1512.8333 1512.8148 12.3 1 6 0.99 +1Score > 38 indicates identity
Score > 18 indicates homology		 SIGNVVSPQDVIKR + 2 Deamidated (NQ)
2668 871.9608 1741.9070 1741.9033 2.18 0 6 0.76 +1Score > 39 indicates identity
Score > 17 indicates homology		 AHATVLDINSSMLSVGK
4745 792.0297 3955.1121 3955.0646 12.0 1 6 0.32 +1Score > 30 indicates identity
Score > 13 indicates homology		 VSKQIMVGNVPVGGNAPITVQSMTNTLTTDVAATVAQIK + 2 Deamidated (NQ)
2759 596.6730 1786.9972 1786.9942 1.69 1 6 0.98 +1Score > 36 indicates identity
Score > 18 indicates homology		 VQVGVIGGTGYVGAELIR
2394 806.4387 1610.8628 1610.8603 1.61 1 6 0.37 +1Score > 38 indicates identity
Score > 14 indicates homology		 RALQQFLYVQMAK + Oxidation (M)
2557 843.9835 1685.9524 1685.9716 -11.4 1 6 0.66 +1Score > 35 indicates identity
Score > 16 indicates homology		 SVVLFELNVDVLLAR
3209 694.3739 2080.0999 2080.1099 -4.82 1 6 0.5 +1Score > 38 indicates identity
Score > 15 indicates homology		 SLQPSVLMQLKLTDGSAHR
2470 822.4241 1642.8336 1642.8613 -16.9 1 6 0.54 +1Score > 40 indicates identity
Score > 15 indicates homology		 TSMAVPPPPRGPAPPR + Oxidation (M)
2200 763.8724 1525.7302 1525.7558 -16.8 1 6 0.85 +1Score > 40 indicates identity
Score > 17 indicates homology		 SCSNLTNLKYLGR + Deamidated (NQ)
2690 581.9799 1742.9179 1742.9203 -1.38 1 6 0.59 +1Score > 39 indicates identity
Score > 16 indicates homology		 ELQLLLNNVDFNPSK
3462 737.0912 2208.2518 2208.2446 3.26 0 6 0.64 +1Score > 31 indicates identity
Score > 16 indicates homology		 SLTIYGLVVALALLFANPFVS + Deamidated (NQ)
1893 461.5930 1381.7572 1381.7428 10.4 0 6 0.88 +1Score > 38 indicates identity
Score > 18 indicates homology		 LLDFMFILQAR + Oxidation (M)
4318 731.3844 2921.5085 2921.5010 2.55 1 6 0.38 +1Score > 36 indicates identity
Score > 14 indicates homology		 HVLKQQTPLWMAQHPDVLAFHQAPK + 2 Deamidated (NQ)
3558 758.3833 2272.1281 2272.1555 -12.1 1 6 0.55 +1Score > 39 indicates identity
Score > 15 indicates homology		 GILTKPQPMTPLDNSISMRR + 2 Deamidated (NQ); Oxidation (M)
3877 841.7885 2522.3437 2522.3090 13.7 1 6 0.31 +1Score > 35 indicates identity
Score > 13 indicates homology		 QFVLGNLDVTIIAQAPKMAPHIE + 2 Deamidated (NQ); Oxidation (M)
3710 790.0858 2367.2356 2367.1965 16.5 1 6 0.53 +1Score > 37 indicates identity
Score > 15 indicates homology		 TQAPQARVMGSQPPLSNSRPTK + Deamidated (NQ); Oxidation (M)
3870 838.4333 2512.2781 2512.2420 14.3 1 6 0.73 +1Score > 38 indicates identity
Score > 17 indicates homology		 FEIVLYGATGFSGMLTGQHLAQR + Deamidated (NQ); Oxidation (M)
946 937.5019 936.4946 936.4851 10.2 1 6 1 +1Score > 40 indicates identity
Score > 18 indicates homology		 TYKLPCR
4201 704.3995 2813.5689 2813.5513 6.25 1 6 0.33 +1Score > 29 indicates identity
Score > 13 indicates homology		 VQLGFALLNFPAMIQSSLRLLEPQK + Deamidated (NQ)
1591 410.9344 1229.7814 1229.7781 2.67 1 6 0.5 +1Score > 23 indicates identity
Score > 15 indicates homology		 ILLVAVSIKMK + Oxidation (M)
2421 808.9371 1615.8596 1615.8313 17.5 0 6 0.7 +1Score > 39 indicates identity
Score > 16 indicates homology		 CLLAGKPMQLDLIE + Oxidation (M)
2798 905.4633 1808.9120 1808.8992 7.10 1 6 0.31 +1Score > 40 indicates identity
Score > 13 indicates homology		 IGTSRFQMHVTNFVR + Deamidated (NQ); Oxidation (M)
Page: Previous 1 …16 17 18 19 20 21 22 23 24 25 26 … 40 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/