| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | Rita3 sp |
| MS data file | : | PRT1270_T-BRSC_3_20250714120051.mgf |
| Database | : | SwissProt 57.15 (515,203 sequences; 181,334,896 residues) |
| Timestamp | : | 12 Aug 2025 at 23:41:29 GMT |
Not what you expected? Try
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | GluC_Trypsin |
| Fixed modifications | : | |
| Variable modifications | : | |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 5,012 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 | 2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | ||||
| 6.2e-007 | 1 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | ||||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle (
) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 705.3937 | 2113.1593 | 2113.1208 | 18.2 | 0 | 8 | 0.21 | 1Score > 35 indicates identityScore > 13 indicates homology |
YVIQVQINPQLASHGGFIK + 2 Deamidated (NQ) | |
| 738.4001 | 2949.5713 | 2949.6298 | -19.8 | 0 | 8 | 1 | 1Score > 33 indicates identityScore > 20 indicates homology |
NLIVNFIIICVLILFQGVMGWLMVK + Deamidated (NQ); Oxidation (M) | |
| 327.2038 | 652.3930 | 652.4020 | -13.8 | 1 | 8 | 0.57 | 1Score > 30 indicates identityScore > 18 indicates homology |
KGAHIK | |
| 925.4091 | 1848.8036 | 1848.7869 | 9.04 | 1 | 7 | 0.27 | 1Score > 37 indicates identityScore > 14 indicates homology |
KMSGHMGAVQQSTQNLE + 4 Deamidated (NQ) | |
| 844.4567 | 1686.8988 | 1686.8763 | 13.4 | 1 | 7 | 0.95 | 1Score > 39 indicates identityScore > 20 indicates homology |
FRPPMSEVVQQLVR + 2 Deamidated (NQ) | |
| 712.3523 | 1422.6900 | 1422.6813 | 6.15 | 1 | 7 | 0.47 | 1Score > 41 indicates identityScore > 17 indicates homology |
VGTPYLNRDLME + Oxidation (M) | |
| 822.0624 | 2463.1654 | 2463.1819 | -6.71 | 0 | 7 | 0.46 | 1Score > 38 indicates identityScore > 17 indicates homology |
VFQAAGADVFAVYTTPDGHNINR + Deamidated (NQ) | |
| 1159.7058 | 1158.6985 | 1158.7046 | -5.24 | 1 | 7 | 0.59 | 1Score > 33 indicates identityScore > 18 indicates homology |
SLPLLMITKK + Oxidation (M) | |
| 862.4762 | 1722.9378 | 1722.9206 | 10.0 | 1 | 7 | 0.68 | 1Score > 37 indicates identityScore > 18 indicates homology |
ITNVLGGRGFSWFLR + Deamidated (NQ) | |
| 1133.6256 | 2265.2366 | 2265.1992 | 16.6 | 1 | 7 | 0.37 | 1Score > 35 indicates identityScore > 16 indicates homology |
TPTTPPVVLINPEIISSSATVE + Deamidated (NQ) | |
| 792.4155 | 791.4082 | 791.4025 | 7.26 | 0 | 7 | 0.97 | 1Score > 42 indicates identityScore > 20 indicates homology |
NSISGVSK + Deamidated (NQ) | |
| 551.6419 | 1651.9039 | 1651.9046 | -0.43 | 1 | 7 | 0.82 | 1Score > 37 indicates identityScore > 19 indicates homology |
VFRLIDLSTGNVYR | |
| 657.6915 | 1970.0527 | 1970.0473 | 2.75 | 1 | 7 | 0.7 | 1Score > 37 indicates identityScore > 18 indicates homology |
QQSLLLQLSDWQIIER + Deamidated (NQ) | |
| 475.2226 | 1422.6460 | 1422.6588 | -9.04 | 0 | 7 | 0.87 | 1Score > 40 indicates identityScore > 19 indicates homology |
VLAFDLQQMIDE + 2 Deamidated (NQ) | |
| 565.6212 | 1693.8418 | 1693.8383 | 2.02 | 1 | 7 | 0.46 | 1Score > 41 indicates identityScore > 17 indicates homology |
FTTSQLTLQDNNRR + Deamidated (NQ) | |
| 860.9283 | 1719.8420 | 1719.8097 | 18.8 | 1 | 7 | 0.86 | 1Score > 41 indicates identityScore > 19 indicates homology |
RPSVDNLSNKNMSIE + Deamidated (NQ); Oxidation (M) | |
| 744.3961 | 2230.1665 | 2230.1667 | -0.12 | 0 | 7 | 1 | 1Score > 38 indicates identityScore > 20 indicates homology |
MAAVILPSTAAPSSLFPASQQK + Oxidation (M) | |
| 979.0334 | 1956.0522 | 1956.0316 | 10.5 | 1 | 7 | 0.88 | 1Score > 37 indicates identityScore > 19 indicates homology |
AISEATDIPQILYNVPGR | |
| 675.3998 | 2023.1776 | 2023.1465 | 15.3 | 1 | 7 | 1 | 1Score > 29 indicates identityScore > 20 indicates homology |
ALWELLLQAILQALSANR + Deamidated (NQ) | |
| 870.7877 | 2609.3413 | 2609.3184 | 8.76 | 1 | 7 | 0.65 | 1Score > 37 indicates identityScore > 18 indicates homology |
AAAGGTIGLVNDGDIINIDIPNRSIE + 2 Deamidated (NQ) | |
| 825.4150 | 1648.8154 | 1648.8396 | -14.6 | 0 | 7 | 0.54 | 1Score > 41 indicates identityScore > 17 indicates homology |
YAVGQGPMWVSVLAR + Oxidation (M) | |
| 902.4734 | 1802.9322 | 1802.9488 | -9.16 | 1 | 7 | 0.99 | 1Score > 40 indicates identityScore > 20 indicates homology |
ALAYMALAPNTPIEAIK + Deamidated (NQ); Oxidation (M) | |
| 836.4276 | 1670.8406 | 1670.8475 | -4.11 | 1 | 7 | 0.4 | 1Score > 40 indicates identityScore > 16 indicates homology |
AVQTLDDLLNAGVEGR + Deamidated (NQ) | |
| 593.3235 | 1184.6324 | 1184.6401 | -6.45 | 0 | 7 | 0.83 | 1Score > 40 indicates identityScore > 19 indicates homology |
SQILGLTNGPGK + Deamidated (NQ) | |
| 1023.5350 | 2045.0554 | 2045.0840 | -14.0 | 1 | 7 | 0.87 | 1Score > 39 indicates identityScore > 19 indicates homology |
GVFSMQQRQALAQISLPR + Oxidation (M) | |
| 837.4681 | 1672.9216 | 1672.9069 | 8.79 | 1 | 7 | 0.54 | 1Score > 37 indicates identityScore > 17 indicates homology |
KLVILGGAMQGNVLDK + 2 Deamidated (NQ); Oxidation (M) | |
| 722.4151 | 2164.2235 | 2164.1813 | 19.5 | 1 | 7 | 0.48 | 1Score > 31 indicates identityScore > 17 indicates homology |
VVQMLVDYITKNSIAGVGLK + Deamidated (NQ); Oxidation (M) | |
| 1126.5188 | 2251.0230 | 2251.0334 | -4.62 | 1 | 7 | 0.88 | 1Score > 38 indicates identityScore > 19 indicates homology |
NAGDFTAVDYSGKNFWFGVR + Deamidated (NQ) | |
| 455.2315 | 1362.6727 | 1362.6939 | -15.6 | 1 | 7 | 0.95 | 1Score > 41 indicates identityScore > 20 indicates homology |
RSICSFNARPR | |
| 772.3735 | 1542.7324 | 1542.7348 | -1.53 | 1 | 7 | 0.66 | 1Score > 40 indicates identityScore > 18 indicates homology |
GVEPAPTAANGGVMKE + Oxidation (M) | |
| 601.0159 | 1800.0259 | 1800.0271 | -0.68 | 1 | 7 | 0.45 | 1Score > 33 indicates identityScore > 16 indicates homology |
LLRHPPVPHQPLGPSR | |
| 607.9697 | 1820.8873 | 1820.8516 | 19.6 | 0 | 7 | 0.64 | 1Score > 40 indicates identityScore > 18 indicates homology |
WQCGTIQVDFNLPSR + Deamidated (NQ) | |
| 701.0502 | 2100.1288 | 2100.1619 | -15.8 | 0 | 7 | 0.74 | 1Score > 36 indicates identityScore > 19 indicates homology |
LLSSQFTFLNVLTYLSVR | |
| 665.8688 | 1329.7230 | 1329.7001 | 17.3 | 0 | 7 | 0.72 | 1Score > 40 indicates identityScore > 18 indicates homology |
LGQGSTLGAQTAAR | |
| 456.5703 | 1366.6891 | 1366.6881 | 0.71 | 1 | 7 | 0.91 | 1Score > 40 indicates identityScore > 19 indicates homology |
IGIWVNHNGVEK + 2 Deamidated (NQ) | |
| 408.9740 | 1631.8669 | 1631.8366 | 18.6 | 1 | 7 | 0.98 | 1Score > 39 indicates identityScore > 20 indicates homology |
GQVDSLLSIISSQRE + Deamidated (NQ) | |
| 476.7474 | 1902.9605 | 1902.9283 | 16.9 | 1 | 7 | 0.46 | 1Score > 40 indicates identityScore > 16 indicates homology |
VLVSSGQVDTGQQQARTE + Deamidated (NQ) | |
| 696.0266 | 2085.0580 | 2085.0320 | 12.5 | 1 | 7 | 0.97 | 1Score > 39 indicates identityScore > 20 indicates homology |
NDYIHALVAYFNIEFTR | |
| 773.4551 | 2317.3435 | 2317.3270 | 7.10 | 1 | 7 | 0.4 | 1Score > 27 indicates identityScore > 16 indicates homology |
ILNIPKLGSVNVHGSILPQYR | |
| 724.8925 | 2895.5409 | 2895.4865 | 18.8 | 0 | 7 | 0.49 | 1Score > 34 indicates identityScore > 17 indicates homology |
VSQDLDVAVIVSSSNSAVALNLNLYFR + 2 Deamidated (NQ) | |
| 802.9614 | 1603.9082 | 1603.9198 | -7.20 | 1 | 7 | 0.78 | 1Score > 34 indicates identityScore > 19 indicates homology |
ALQAGRKPAYLIFR + Deamidated (NQ) | |
| 623.6752 | 1868.0038 | 1868.0077 | -2.12 | 1 | 7 | 1 | 1Score > 37 indicates identityScore > 20 indicates homology |
THLPVSDMVVNAVKTLK + Deamidated (NQ); Oxidation (M) | |
| 966.5490 | 1931.0834 | 1931.0615 | 11.4 | 0 | 7 | 0.79 | 1Score > 33 indicates identityScore > 19 indicates homology |
LVDFLVNVQSILNAASVK + 2 Deamidated (NQ) | |
| 1023.4853 | 2044.9560 | 2044.9800 | -11.7 | 1 | 7 | 0.67 | 1Score > 39 indicates identityScore > 18 indicates homology |
LTVGTANDNQQLQQLIRE + 5 Deamidated (NQ) | |
| 1043.0345 | 2084.0544 | 2084.0150 | 18.9 | 1 | 7 | 0.81 | 1Score > 39 indicates identityScore > 19 indicates homology |
KGNVMGTYIHGVFDGVSFR + Deamidated (NQ) | |
| 554.2986 | 1106.5826 | 1106.5972 | -13.1 | 0 | 7 | 0.86 | 1Score > 41 indicates identityScore > 19 indicates homology |
GYLLQTLGDK | |
| 501.9638 | 1502.8696 | 1502.8569 | 8.43 | 1 | 7 | 0.79 | 1Score > 33 indicates identityScore > 19 indicates homology |
VSSFDVAIIAGRLR | |
| 712.8323 | 1423.6500 | 1423.6579 | -5.50 | 1 | 7 | 0.89 | 1Score > 40 indicates identityScore > 19 indicates homology |
ENLNNHLQSQPK + 3 Deamidated (NQ) | |
| 479.2636 | 1434.7690 | 1434.7943 | -17.6 | 1 | 7 | 0.79 | 1Score > 39 indicates identityScore > 19 indicates homology |
DAVGHIVSKPQKR + Deamidated (NQ) | |
| 365.2095 | 1092.6067 | 1092.5928 | 12.7 | 1 | 7 | 0.69 | 1Score > 37 indicates identityScore > 18 indicates homology |
RVGAVDVSYK | |
| 502.5970 | 1504.7692 | 1504.7643 | 3.27 | 1 | 7 | 0.86 | 1Score > 41 indicates identityScore > 19 indicates homology |
WALQAMGKMAGGIR + Oxidation (M) | |
| 765.4341 | 1528.8536 | 1528.8759 | -14.6 | 1 | 7 | 0.52 | 1Score > 37 indicates identityScore > 17 indicates homology |
IVQTLCTVRGAALK | |
| 489.6343 | 1465.8811 | 1465.8518 | 20.0 | 1 | 7 | 0.34 | 1Score > 30 indicates identityScore > 15 indicates homology |
VLLNNFRVVHVR + Deamidated (NQ) | |
| 707.7049 | 2120.0929 | 2120.0969 | -1.91 | 1 | 7 | 0.81 | 1Score > 38 indicates identityScore > 19 indicates homology |
QADLMIVAGTLTNKMASALR + Deamidated (NQ); Oxidation (M) | |
| 746.4047 | 2236.1923 | 2236.2150 | -10.2 | 1 | 7 | 0.93 | 1Score > 36 indicates identityScore > 19 indicates homology |
MFLQARAALVTGGALYIVGNR + Oxidation (M) | |
| 938.4586 | 2812.3540 | 2812.3412 | 4.54 | 1 | 7 | 0.25 | 1Score > 37 indicates identityScore > 14 indicates homology |
IGDRCQLVGDDLFVTNVDFLAMGIE + Oxidation (M) | |
| 456.4877 | 1821.9217 | 1821.9182 | 1.90 | 1 | 7 | 1 | 1Score > 40 indicates identityScore > 20 indicates homology |
NSGLFDMKDVLNLDLL + Oxidation (M) | |
| 975.5182 | 1949.0218 | 1948.9934 | 14.6 | 1 | 7 | 0.47 | 1Score > 38 indicates identityScore > 16 indicates homology |
LAGGFNIADLFPSAKWLE + Deamidated (NQ) | |
| 721.0303 | 2160.0691 | 2160.0658 | 1.50 | 0 | 7 | 0.88 | 1Score > 39 indicates identityScore > 19 indicates homology |
ISGGNLGSTSLQDNNSQDLIK | |
| 1041.5406 | 2081.0666 | 2081.1058 | -18.8 | 0 | 7 | 0.83 | 1Score > 39 indicates identityScore > 19 indicates homology |
ISIINIYAPNHNAPQFIR + Deamidated (NQ) | |
| 333.8359 | 998.4859 | 998.4709 | 15.0 | 1 | 7 | 0.85 | 1Score > 40 indicates identityScore > 19 indicates homology |
LGESFNGFK + Deamidated (NQ) | |
| 709.7225 | 2126.1457 | 2126.1736 | -13.1 | 1 | 7 | 0.65 | 1Score > 36 indicates identityScore > 18 indicates homology |
LFVDTLLTVQPLQNQEIR | |
| 1013.2379 | 4048.9225 | 4048.8472 | 18.6 | 1 | 7 | 0.41 | 1Score > 33 indicates identityScore > 16 indicates homology |
LQHQWDAISGMPTNLYGQNDNFHPENSHVLPALMR + 3 Deamidated (NQ); Oxidation (M) | |
| 989.5334 | 1977.0522 | 1977.0306 | 10.9 | 0 | 7 | 0.37 | 1Score > 38 indicates identityScore > 15 indicates homology |
QAQALGITPTPQPITLTPE + 2 Deamidated (NQ) | |
| 786.7590 | 2357.2552 | 2357.2267 | 12.1 | 1 | 7 | 0.71 | 1Score > 36 indicates identityScore > 18 indicates homology |
VNQKVYSVPLTANVSGIYYNK + Deamidated (NQ) | |
| 441.2394 | 880.4642 | 880.4477 | 18.8 | 0 | 7 | 0.91 | 1Score > 40 indicates identityScore > 19 indicates homology |
MFLDSIR | |
| 682.3595 | 2044.0567 | 2044.0337 | 11.2 | 1 | 7 | 0.91 | 1Score > 39 indicates identityScore > 19 indicates homology |
RAAQLAGDIAYQEPDAVTR | |
| 1091.5531 | 2181.0916 | 2181.0922 | -0.27 | 1 | 7 | 0.96 | 1Score > 39 indicates identityScore > 19 indicates homology |
VLVENDVDPAVCCVLIGPGR | |
| 644.7017 | 1931.0833 | 1931.0887 | -2.79 | 1 | 7 | 1 | 1Score > 33 indicates identityScore > 20 indicates homology |
MINIVNNKVNIIHRPR + Deamidated (NQ) | |
| 1016.5051 | 2030.9956 | 2030.9740 | 10.7 | 1 | 7 | 0.48 | 1Score > 40 indicates identityScore > 16 indicates homology |
ILCFASACNDFSVRMLK | |
| 1068.0995 | 2134.1844 | 2134.1642 | 9.47 | 1 | 7 | 0.71 | 1Score > 33 indicates identityScore > 18 indicates homology |
VVATMGNVISLFLRMQDLK | |
| 426.5832 | 1276.7278 | 1276.7139 | 10.9 | 1 | 7 | 0.47 | 1Score > 36 indicates identityScore > 16 indicates homology |
FNRTLNLISAK + Deamidated (NQ) | |
| 660.6959 | 1979.0659 | 1979.0840 | -9.16 | 1 | 7 | 0.79 | 1Score > 37 indicates identityScore > 18 indicates homology |
IVVLDFGSQYTQLIARR + Deamidated (NQ) | |
| 579.0666 | 2312.2373 | 2312.2045 | 14.2 | 1 | 7 | 0.36 | 1Score > 36 indicates identityScore > 15 indicates homology |
KQSVPANILSLQLQQMAANLE + Deamidated (NQ); Oxidation (M) | |
| 1068.5629 | 2135.1112 | 2135.0858 | 11.9 | 1 | 7 | 0.78 | 1Score > 38 indicates identityScore > 18 indicates homology |
ILLSLDNQDLEINQVNHR + 2 Deamidated (NQ) | |
| 592.3479 | 591.3406 | 591.3302 | 17.7 | 0 | 7 | 0.53 | 1Score > 36 indicates identityScore > 17 indicates homology |
LLSLM + Oxidation (M) | |
| 925.8408 | 2774.5006 | 2774.4499 | 18.3 | 1 | 7 | 0.83 | 1Score > 33 indicates identityScore > 19 indicates homology |
RGNVMGIALGGLAMGVLVGPPFGSVLYE + Deamidated (NQ) | |
| 724.3818 | 2170.1236 | 2170.1391 | -7.15 | 1 | 7 | 0.94 | 1Score > 38 indicates identityScore > 19 indicates homology |
VLALRCLQSGIHFAMPGATK + Deamidated (NQ) | |
| 395.7086 | 789.4026 | 789.4167 | -17.8 | 1 | 7 | 0.82 | 1Score > 42 indicates identityScore > 19 indicates homology |
KADVMAR | |
| 908.5202 | 1815.0258 | 1815.0368 | -6.04 | 1 | 7 | 0.62 | 1Score > 34 indicates identityScore > 17 indicates homology |
LELIPVYLLLAMWGGK | |
| 464.2611 | 1389.7615 | 1389.7881 | -19.2 | 1 | 7 | 0.73 | 1Score > 39 indicates identityScore > 18 indicates homology |
GSPLPHVTWKLR | |
| 606.9642 | 1817.8708 | 1817.8716 | -0.48 | 0 | 7 | 0.79 | 1Score > 40 indicates identityScore > 18 indicates homology |
GQGKPLNVDLSNNMLSK + 4 Deamidated (NQ) | |
| 986.8685 | 2957.5837 | 2957.5248 | 19.9 | 0 | 7 | 0.65 | 1Score > 33 indicates identityScore > 18 indicates homology |
YAAYGLVMPSLVLNYFGQGALLIQNPK + 2 Deamidated (NQ); Oxidation (M) | |
| 419.5679 | 1255.6819 | 1255.6601 | 17.3 | 0 | 7 | 0.68 | 1Score > 40 indicates identityScore > 18 indicates homology |
FQNNFVFIVK + Deamidated (NQ) | |
| 757.9524 | 1513.8902 | 1513.9079 | -11.7 | 1 | 7 | 0.62 | 1Score > 32 indicates identityScore > 17 indicates homology |
IIVGTLINVGTGKTK + Deamidated (NQ) | |
| 475.2290 | 1422.6652 | 1422.6708 | -3.93 | 1 | 7 | 0.92 | 1Score > 41 indicates identityScore > 19 indicates homology |
TGGRNNTGMIMVR + Deamidated (NQ); Oxidation (M) | |
| 664.3865 | 1326.7584 | 1326.7581 | 0.29 | 0 | 7 | 0.58 | 1Score > 37 indicates identityScore > 17 indicates homology |
LLSMLPINALNK + Deamidated (NQ) | |
| 618.3241 | 1851.9505 | 1851.9513 | -0.43 | 0 | 7 | 0.73 | 1Score > 39 indicates identityScore > 18 indicates homology |
NVLQVHLNGLMQINDK + Deamidated (NQ); Oxidation (M) | |
| 418.2625 | 834.5104 | 834.5076 | 3.45 | 0 | 7 | 0.91 | 1Score > 33 indicates identityScore > 19 indicates homology |
VPLHLTR | |
| 378.8978 | 1133.6716 | 1133.6782 | -5.81 | 1 | 7 | 0.82 | 1Score > 33 indicates identityScore > 18 indicates homology |
GVLRAHQVVR | |
| 591.3680 | 1180.7214 | 1180.7179 | 2.98 | 1 | 7 | 0.53 | 1Score > 31 indicates identityScore > 17 indicates homology |
KIPNLLDLQK | |
| 927.4830 | 2779.4272 | 2779.4466 | -6.98 | 1 | 7 | 1 | 1Score > 36 indicates identityScore > 19 indicates homology |
MHILQAVLTNELAFDNAKPVISPLE + Deamidated (NQ); Oxidation (M) | |
| 822.1147 | 2463.3223 | 2463.3009 | 8.67 | 0 | 7 | 0.25 | 1Score > 35 indicates identityScore > 13 indicates homology |
IAVAHYAAQLSTLDINPQPLSLE | |
| 643.6592 | 1927.9558 | 1927.9673 | -5.98 | 0 | 7 | 0.62 | 1Score > 40 indicates identityScore > 17 indicates homology |
SQLTLVLVTHNMQQAAR + 3 Deamidated (NQ); Oxidation (M) | |
| 1134.0763 | 2266.1380 | 2266.1805 | -18.7 | 1 | 7 | 0.62 | 1Score > 39 indicates identityScore > 17 indicates homology |
NPIQDIKITSDTNVPVNAGIR + 2 Deamidated (NQ) | |
| 659.8719 | 1317.7292 | 1317.7153 | 10.6 | 1 | 7 | 0.94 | 1Score > 39 indicates identityScore > 19 indicates homology |
IRSLVGQDQFR | |
| 581.9833 | 1742.9281 | 1742.9243 | 2.18 | 0 | 7 | 0.82 | 1Score > 39 indicates identityScore > 18 indicates homology |
YAIIFNLLAHKPNVE + 2 Deamidated (NQ) | |
| 906.0357 | 1810.0568 | 1810.0352 | 11.9 | 1 | 7 | 0.43 | 1Score > 30 indicates identityScore > 16 indicates homology |
EPIFVIAELNLIGLNR | |
| 971.5365 | 1941.0584 | 1941.0935 | -18.1 | 0 | 7 | 0.42 | 1Score > 36 indicates identityScore > 16 indicates homology |
LLIVDRPIDQIAPVIHE + Deamidated (NQ) | |
| 922.8442 | 2765.5108 | 2765.4633 | 17.1 | 1 | 7 | 0.36 | 1Score > 32 indicates identityScore > 15 indicates homology |
LGGAVAGKIGAGDTAVTVVADLPTGAMKPE |
Not what you expected? Try
the select summary.